Epidemiologia molecular del virus de l'hepatitis E (VHE) en zones industrialitzades

237  Descargar (0)

Texto completo

(1)
(2)
(3)

Aggarwal, R., Shahi, H., Naik, S., Yachha, S.K. i Naik, S.R. Evidence in favour of high infection rate with hepatitis E virus among young children in India. Journal of Hepatology,

1997; 26: 1425-1430.

Aggarwal, R., McCaustland K.A., Dilawari J.B., Sinha, S.D. i Robertson B.H. Genetic variability of hepatitis E virus within and between three epidemics in India. Virus Research, 1999; 59: 35-48.

Aggarwal, R. i Krawczynski, K. Hepatitis E: an overview and recent advances in clinical and laboratory research. Journal of Gastroenterology and Hepatology, 2000; 15: 9-20.

Aggarwal, R., Kini, D., Sofat, S., Naik, S.R. i Krawczynski, K. Duration of viremia and faecal viral excretion in acute hepatitis. Lancet, 2000; 356: 1081-1082.

Aggarwal, R., Kamili, S., Spelbring, J i Krawczynski, K. Experimental studies on subclinical hepatitis E virus infection in cynomolgus macaques. Journal of Infectious Diseases, 2001; 184: 1380-1385.

Arankalle, V.A., Chadha, M.S., Tsarev, S.A., Emerson, S.U., Risbud, A.R., Banerjee, K. i Purcell, R.H. Seroepidemiology of water-borne hepatitis in India and evidence for a third enterically-transmitted hepatitis agent. Proceedings of the National Academy of Science USA, 1994; 91: 3428-3432.

Arankalle, V.A., Tsarev, S.A., Chadha, M.S., Alling, D.W., Rmerson, S.U., Banerjee, K. i Purcell, R.H. Age-specific prevalence of antibodies to hepatitis A and E viruses in Pune, India, 1982 and 1992. Journal of Infectious Diseases, 1995; 171: 447-450.

Arankalle, V.A. i Chobe, L.P. Hepatitis E virus: can it be transmitted parenterally? Journal of Viral Hepatitis, 1999; 6 (2): 161-4.

Arankalle, V.A., Paranjape, S., Emerson, S.U., Purcell, R.H. i Walimbe, A.M. Phylogenetic analysis of hepatitis E virus isolates from India (1976-1993). Journal of General Virology, 1999; 80: 1691-1700.

(4)

Arankalle, V.A., Chobe, L.P., Joshi, M.V., Chadha, M.S., Kundu, B. i Walimbe, A.M. Human and swine hepatitis E viruses from Western India belong to different genotype. Journal of Hepatology, 2002; 36: 417-425.

Arankelle, V.A., Chobe, L.P., Walimbe, A.M., Yergolkar, P.N. i Jacob, G.P. Swine HEV infection in South India and phylogenetic analysis (1985-1999). Journal of Medical Virology, 2003; 69: 391-396.

Arinsoy, T., Yilmaz, M., Derici, U., Sindel, S., Tekin, I. i Hasanoglu, E. Prevalence of hepatitis E virus antibody in hemodialysis patients. Nephron, 1998; 80 (1): 85.

Arora, N.K., Panda, S.K., Nanda, S.K., Ansari, I.H., Joshi, J., Dixit, R. i Bathla, R. Hepatitis E infection in childen: study of an outbreak. Journal of Gastroenterology and Hepatology, 1999; 14: 572-577.

Ayoola, E.A., Want, M.A., Gadoru, M.O.E.H., Al-Hazmi, M.H. i Hamza, M.K.M. Hepatitis e virus infection in haemodyalisis patients: a case-control study in Saudi Arabia. Journal of Medical Virology, 2002; 66:329-334.

Bader, T.F., Krawczynski, K., Polish, L.B. i Favorov M.O. Hepatitis E in a U.S. traveler to Mexico. The New England Journal of Medicine, 1991; 325: 1659.

Balayan, M.S. Andjaparidze, A.G., Savinskaya, S.S., Ketiladze, E.S., Braginsky, D.M., Savinov, A.P. i Poleschuk, V.F. Evidence for a virus in non-A, non-B hepatitis transmitted via the fecal-oral route. Intervirology, 1983; 20: 23-31.

Balayan, M.S., Usmanov, R.K., Zamyatina, N.A. Djumalieva, D.I. i Karas, F.R. Brief report: Experimental hepatitis E infection in domestic pigs. Journal of Medical Virology, 1990; 32: 58-59.

Balayan, M.S. Hepatitis E virus infection in Europe: regional situation regarding laboratory diagnosis and epidemiology. Clinical and Diagnostic Virology, 1993; 1: 1-9.

Balayan, M.S. Epidemiology of hepatitis E virus infection. Journal of Viral Hepatitis, 1997; 4: 155-165.

(5)

Bissuel, F., Houhou, N., Leport C., Brun-Vezinet, F. i Vildé, J.L. Hepatitis E antibodies and HIV status. Lancet, 1996; 347: 1494

Bofill-Mas, S., Formiga-Cruz, M., Clemente-Casares, P., Calafell, F. i Girones, R. Potential transmission of human polyomaviruses through the gastrointestinal tract after exposure to virions or viral DNA. Journal of Virology, 2001; 75 (21): 10290-10299.

Bofill-Mas, S., Pina, S. i Girones, R. Documenting the epidemiologic patterns of polyomaviruses in human populations by studying their presence in urban sewage. Applied of Environmental Microbiology, 2000; 66 (1):238-245.

Boom, R., Sol, C.J.A., Salimans, M.M.M., Jansen, C.J., Wertheim-van Dillen, P.M.E., Van der Noordaa. J. Rapid and simple method for purification of nucleic acids. Journal of Clinical Microbiology, 1990; 28: 495-503.

Bradley, D.W., Krawczynski, K., Cook, E.H., McCaustland, K.A., Humphrey, C.D., Spelbring, J.E., Myint, H. i Maynard, J.E. Enterically transmitted non-A, non-B hepatitis: serial passage of disease in cynomolgus macaques and tamarins and recovery of disease-associated 27- to 34-nm viruslike particles. Proceedings of the National Academy of Science USA, 1987; 84: 6277-6281.

Bradley, D.W. i Balagan, M.S. Virus of enterically transmitted non-A, non-B hepatitis. Lancet, 1988; 1: 819.

Bradley, D.W., Purdy, M.A. i Reyes, G.R. Hepatitis e virus genome: molecular features, expression of immunoreative proteins and sequence divergence. Journal of Hepatology,

1991; 13 (Suppl. 4): S152-S154.

Bradley, D.W. Hepatitis E: epidemiology, aetiology and molecular biology. Review of Medical Virology, 1992; 2: 19-28.

Bradley, D.W. Hepatitis E virus. In: Webster, R.G. and Granoff, A. (eds). Encyclopedia of Virology. Academic Press Ltd, London, 1994: 580-586.

(6)

Buti, M., Jardí, R., Cotrina, M., Rodríguez-Frias, F., Troonen, H., Viladomiu, L., Esteban, J.I., Esteban, R. i Guardia, J. Hepatitis E virus infection in acute hepatitis in Spain. Journal of Virological Methods, 1995; 55: 49-54.

Cacopardo, B., Russo, R., Preiser, W., Benanti, F., Brancati, G., Nunnari, A. Acute hepatitis E in Catania (eastern Sicily) 1980-1994. The role of hepatitis E virus. Infection, 1997; 25 (5): 313-316.

Chandler, J.D., Riddell, M.A., Li, F., Love, R.J. i Anderson, D.A. Serological evidence for swine hepatitis E virus infection in Australian pig herds. Veterinary Microbiology, 1999; 68: 95-105.

Chauhan, A., Jameel, S., Dilawari, J.B., Charla, Y.K., Kaur, U. i Ganguly, N.K. Hepatitis E virus transmission to a volunteer. Lancet, 1993; 341 (8838): 149-50.

Clayson, E.T., Myint, K.S.A., Snitbhan, R., Vaughn, D.W., Inni, B.L., Chan, L., Cheung, P. I Shrestha, M.P. Viremia, fecal shedding, and IgM and IgG responses in patients with hepatitis E. Journal of Infectious Diseases, 1995; 172: 927-933.

Cohen, J.I., Ticehurst, R., Purcell, R.H., Bucker-White, A., Baroudy, B.M. Complete nucleotide sequence of wild-type hepatitis A virus: comparison with different strains of hepatitis A virus and other picornavirus. Journal of Virology, 1987; 61 (1): 50-59.

Cooper, K., Huang, F.F., Batista, L., Rayo, C.D., Bezanilla, J.C., Coth, T.E., I Meng, X.J. Identification of genotype 3 hepatitis E virus (HEV) in serum and fecal samples from pigs in Thailand and Mexico, where genotype 1 and 2 HEV strains are prevalent in the respective human populations. Journal of Clinical Microbiology, 2005; 43 (4): 1684-1688.

Corwin, A.L., Tien, N.T.K., Bounlu, K., Winarno, J., Putri, K.P., Laras, K., Larasati, R.P., Sukri, N., Sulaiman, H.A. i Hyams, K.C. The unique riverine ecology of hepatitis E virus transmission in South-East Asia. Transactions of the Royal Society of Tropical Medicine and Hygiene, 1999; 93:255-260.

Coursaget, P., Depril, N., Buisson, Y., Molinie, C. i Roue, R. Hepatitis type in a French population: detection of anti-HEV by a synthetic peptide-based enzyme-linked immunosorbent assay. Research in Virology, 1994; 145: 51-57.

(7)

Dawson, G.J., Chau, K.H., Cabal, C.M., Yarbough, P.O., Reyes, G.R. i mushahwar, I.K. Solid-phase enzyme-linked immunosorbent assayfor hepatitis E virus IgG and IM antibodies utilizing recombinant antigens and synthetic peptides. Journal of Virological Methods, 1992b; 38: 175-186.

Drobeniuc, J., Favorov, M.O., Shapiro, C.N., Bell, B.P., Mast, E.E., Dadu, A., Culver, D., Iarovoi, P., Robertson, B.H., Margolis, H.S. Hepatitis E virus antibody prevalence among persons who work with swine. Journal of Infection Diseases, 2001; 184 (12): 1594-7.

Emerson, S.U. i Purcell, R.H. Recombinant vaccines for hepatitis E. Trends in Molecular Medicine, 2001; 7 (10): 462-466.

Emerson, S.U. i Purcell, R.H. Hepatitis E virus. Review of Medical Virology. 2003; 13: 145-154.

Erker, J.C., Desai, S.M., Schlauder, G.G., Dawson G.J. i Mushahwar, I.K. A hepatitis e virus variant from the United States: molecular characterization and transmission in cynomolgus macaques. Journal of General Virology, 1999a; 80: 681-690.

Erker, J.C., Desai, S.M., Mushahwar, I.K. Rapid detection of Hepatitis E virus RNA by reverse transcription-polymerase chain reaction using universal oligonucleotide primers. Journal of Virological Methods, 1999b; 81: 109-113.

Fix, A.D. Prevalence of antibodies to hepatitis e virus in rural Egyptian communities. American Journal of Tropical Medicine and Hygiene, 2011; 62: 519-523.

Formiga-Cruz, M., Allard, A.K., Conden-Hansson, AC., Henshilwood, K., Hernroth, B.E., Jofre, J., Lees, D.N., Lucena, F., Papapetropoulou, M., Rangdale, R.E., Tsibouxi, A., Vantarakis, A. i Girones, R. Evaluation of potential indicators of viral contamination in shellfish and their applicability to diverse geographical areas. Applied and Environmental Microbiology, 2003; 69 (3):1556-1563.

Garkavenko, O., Obriadina, A., Meng, J., Anderson, D.A., Benard, H.J., Schroeder, B.A., Khudyakov, Y.E., Fields, H.A. i Croxson, M.C. Detection and characterisation of swine hepatitis E virus in New Zealand. Journal of Medical Virology, 2001; 65: 525-529.

(8)

Goldsmith, R., Yarbough, P.O., Reyer, G.R., Fry, K.E., Gabor, K.A., Kamel, M., Zakaria, S., Amer, S. i Gaffar, Y. Enzyme-linked immunosorbent assay for diagnosis of acute sporadic hepatitis E in Egyptian children. Lancet, 1992; 339: 328-331.

Grieco, A. Miele, L., Gasbarrini, G. i Grillo, R. Sporadic HEV hepatitis in Italy. Gut, 2001; 48:578–584.

Halbur, P.G., Kasorndorkbua, C., Gilbert, C., Guenette, D., Potters, M.B., Pucell, R.H., Emerson, S.U., Toth, T.E. i Meng, X.J. Comparative pathogenesis of infection of pigs with hepatitis E viruses recovered from a pig and a human. Journal of Clinical Microbiology, 2001; 39 (3): 918-923.

Haqshenas, G., Shivaprasad, H.L.,Woolcock, P.R., Read, D.H. i Meng, X.J. Genetic identification and characterization of a novel virus related to human hepatitis E virus from chickens with hepatitis-splenomegaly syndrome in the United States. Journal of General Virology, 2001; 82: 2449-2462.

Haqshenas, G., Huang, F.F., Fenaux, M., Guenette, D.K., Person, F.W., Larsen, C.T., Shivaprasad, H.L., Toth, T.E. i Meng, X.J. The putative capsid protein of the newly identified avian hepatitis E virus shares antigenic epitopes with that of swine and human hepatitis E viruses and chicken big liver and spleen disease virus. Journal of general virology,

2002; 83: 2201-2209.

Harrison, T.J. Hepatitis E virus- an update. Liver, 1999; 19: 171-176.

Hau, C.H., Hien, T.T, Tien, N.T.K., Khiem, H.B., Sac, P.K., Nhung, V. T., Larasati., R.P., Putri, M.P., Doss, R., Hyams, K.C. i Corwin, A.L. Prevalence of enteric hepatitis A and E viruses in the Mekong River Delta region of Vietnam. American Journal of Tropical Medicine and Hygiene, 1999; 60: 277-280.

He, J., Hoffman, S.L. i Hayes, C.G. DNA inoculation with a plasmid vector carrying the hepatitis E virus structural protein gene induces immune response in mice. Vaccine, 1997; 15

(4): 357-362.

(9)

Hirano, M., Ding, X., Li, T.C., Takeda, N., Kawabata, H., Koizumi, N., Kadosaka, T., Goto, I., Mazukawa, T., Nakamura, M., Taira, K., Kuroki, T., Tanikawa, T., Watanabe, H. i Abe, K. Evidence for widespread infection of hepatitis E virus among wild rats in Japan. Hepatology Research, 2003a; 27: 1-5.

Hirano, M., Ding, X., Tran, H.T.T., Li, T.C., Takeda, N., Sata, T., Nakamura, S. i Abe, K. Prevalence of antibodies against hepatitis E virus in various species of non-human primates: evidence of widespread infection in Japanese monkeys (Macaca fuscata). Japanese Journal of Infectious Diseases, 2003b; 56: 8-11.

Hsieh, S.Y., Yang, P.Y., Ho, Y.P., Chu, C.M. i Liaw, Y.F. Identification of a novel strain of hepatitis E virus responsible for sporadic acute hepatitis in Taiwan. Journal of Medical Virology, 1998; 55: 300-304.

Hsieh, S., Meng, X., Wu, Y., Liu, S., Tam, A., Lin, D. i Liaw, Y. Identity of a novel swine hepatitis E virus in Taiwan forming a monophyletic group with Taiwan isolates of human hepatitis E virus. Journal of Clinical Microbiology, 1999; 37: 3828-3834.

Huang, C.C., Nguyen D., Fernandez, J., Yun, K.Y., Fry, K.E., Bradley, D.W., Tam, A.W. i Reyes, G.R. Molecular cloning and sequencing of the Mexico isolate of hepatitis E virus (HEV). Virology, 1992; 1991: 550-558.

Huang, F.F., Haqshenas, G., Shivaprasad, H.L., Guenette, D.K., Woolcock, P.R., Larsen, C.T., Pierson, F.W., Elvinger, F., Toth, T.E. i Meng, T.X. Heterogeneity and seroprevalence of a newly identified avian hepatitis E virus from chickens in the United States. Journal of Clinical Microbiology, 2002; 40 (11): 4197-4202.

Huang, F.F., Sun, Z.F., Emerson, S.U., Purcell, R.H., Shivaprasad, H.L., Pierson, F.W., Toth, T.E. i Meng, X.J. Determination and analysis of the complete genomic sequence of avian hepatitis E virus (avian HEV) and attempts to infect rhesus monkeys with avian HEV. Journal of General Virology, 2004; 85 (Pt 6): 1609-1618.

Ishikawa, K., Matsui, K., Madarame, T., Sato, S., Oikawa, K., i Uchida, T. Hepatitis E probably contracted via a Chinese herbal medicine, demonstrated by nucleotide sequencing. Journal of Gastroenterology. 1995; 30: 534-538.

(10)

Kabrane-Lazizi, Y., Meng, X.J., Purcell, R.H. i Emerson, S.U. Evidence that the genomic RNA of hepatitis E virus is capped. Journal of Virology, 1999a; 73: 8848-8850.

Kabrane-Lazizi, Y., Fine, J.B., Elm, J., Glass, G.E., Higa, H., Diwan, A., Gibbs, C.J. Jr., Meng, X.J., Emerson, S.U., Purcell, R.H. Evidence for widespread infection of wild rats with hepatitis E virus in the United States. American Journal of Tropical Medicine and Hygiene, 1999b; 61: 331-335.

Kamili, S., Spelbring, J. i Krawczynski, K. DNA vaccination against hepatitis E virus infection in cynomolgus macaques. Journal of Gastroenterology and Hepatology, 2002; 17: S365-S369.

Kamili, S., Spelbring, J., Carson, D. i Krawczynski, K. Protective efficacy of hepatitis E virus DNA vaccine administered by Gene Gun in the cynomolgus macaque model of infection. Journal of Infectious diseases, 2004; 189: 258-264.

Karetnyi, Y.V., Dzhumalieva, D.I., Usmanov, R.K., Titova, I.P., Litvak, I.I. i Balayan, M.S. Possible involvement of rodents in the spread of viral hepatitis E. Zhurnal Mikrobiologii, Epidemiologii, i Immunobiologii, 1993; 4: 52-56.

Kasorndorkbua, C., Thacker, B.J., Halbur, P.G., Guenette, D.K., Buitenwerf, R.M., Royer, R.L. i Meng, X.J. Experimental infection of pregnant gilts with swine hepatitis E virus. The Canadian Journal of Veterinary Research, 2003; 67: 303-306.

Kasorndorkbua, C., Thomas, P.J., Halburn, P.G., Guenette, D.K., Huang, F.F. I Meng, X.J. Infection of pigs with avian hepatitis e virus (HEV). A.S. Leaflet R1982. Iowa State University Animal Industry report 2005.

http://www.ans.iastate.edu/bis/report/air/2005pdf/1982.pdf

Khudyakov, Y.E., Khudyakova, N.S., Fields, H.A., Jue, D., Starling, C., Favorov, M.O., Krawczynski, K., Polish, L., Mast, E. i Margolis, H. Epitope mapping in proteins of Hepatitis E virus. Virology, 1993; 194: 89-96.

Khudyakov, Y.E., Favorov, M.O., Jue, D.L., Hine, K. i Fields, H.A. Immunodominant antigenic regions in a structural protein of the Hepatitis E virus. Virology, 1994; 198:

(11)

Khuroo, M.S. Study of an epidemic non-A, non-B hepatitis: possibility of another human virus distinct from post-transfusion non-A, non-B type. American Journal of Medicine, 1980;

68: 818-824.

Khuroo, M. S. i Dar, M.Y. Hepatitis E: Evidence for person-to-person transmission and inability of low dose immune serum globulin from an Indian source to prevent it. Indian Journal of Gastroenterology, 1992; 11: 113-116.

Khuroo, M.S. i Kamili, S. Hepatitis E: from hypothesis to reality. Indian Journal of Gastroenterology, 1994; 13 (2): 39-43.

Khuroo, M.S., Kamili, S. i Jameel, S. Vertical transmission of hepatitis E virus. Lancet, 1995; 345 (8956): 1025-6.

Khuroo, M.S. i Kamili, S. Aetiology, clinical course and outcome of sporadic acute viral hepatitis in pregnancy. Journal of Viral Hepatitis, 2003; 10: 61-69.

Khuroo, M.S., Kamili, S. i Yattoo, G.N. Hepatitis E virus infection may be transmitted through blood transfutions in an endemic area. Journal of Gastroenterology and Hepatology, 2004; 19: 778-784.

Koonin, E.V., Gorbalenya, A.E., Purdy, M.A., Rozanov, M., Reyer, G.R. i Bradley, D.W. Computer-assisted assignment of functional domains in the non-structural polyprotein of hepatitis E virus: delineation of an additional group of positive-strand RNA plant and animal viruses. Proceedings of the National Academy of Science USA, 1992; 89: 8259-8263.

Koonin, E.V. i Dolja, V.V. Evolution and taxonomy of positive-strand RNA viruses: implication of comparative analysis of amino acid sequences. Critical Reviews in Biochemistry and Molecular Biology, 1993; 28: 375-430.

Koshy, A., Grover, S., Hyams, K.C., Shabrawy, M.A., Pacsa, A., al-Nakib, B., Zaidi, S.A., al-Anezi, A.A., al-Mufti, S., Burans, J., Carl, M., Richards, A.L. Short-term IgM and IgG antibody responses to hepatitis E virus infection. Scandinavian Journal of Infectious Disesases, 1996; 28 (5): 439-41.

(12)

Kwo, P.Y., Schlauder, G.G., Carpenter, H.A., Murphy, P.J. Rosenblatt, J.E., Dawson, G.J., Mast, E.E., Krawczynski, K. i Balan, V. Acute hepatitis E by a new isolate acquired in the United States. Mayo Clinic Proceedings, 1997; 72:1133-1136.

Li, T.C., Zhang, J., Shinzawa, H., Sta, M., Mast, E.E., Kim, K., Miyamura, T. I Takeda, N. Empty virus-like particle-based enzyme-linked immunosorbent assay for antibodies ti hepatitis E virus. Journal of Medical Virology, 2000; 62: 327-333.

Lok, A.S.F. i Soldevila, C. Epidemiology and serologic diagnosis of hepatitis E. Journal of Hepatology, 1994; 20: 567-569.

Ma, Y., Lin, S.Q., Gaio, Y., Li, M., Luo, W.X., Zhang, J. i Xia, N.S. Expression of ORF2 partial gene of hepatitis E virus in tomatoes and immunoactivity of expression products. World Journal of Gastroenterology, 2003; 9 (10): 221-2215.

Maneerat, Y., Clayson, E.T., Myint, K.S., Young, G.D. i Innis, B.L. Experimental infection of the laboratory rat with the hepatitis E virus. Journal of Medical Virology, 1996;

48: 121-128.

Mansuy, J.M., Peron, M., Bureau, C., Alric, L., Vinel, J.P. i Izopet, J. Immunologically silent autochthonous acute Hepatitis E Virus infection in France. Journal of Clinical Microbiology, 2004; 42 (2): 912–913.

Margolis, H.S., Alter, M.J. i Hadler, S.C. Viral Hepatitis. In: Evans, A.S. & Kaslow, R.A. (eds). Viral infections of humans: epidemiology and control, 4th

edition. New York, 1997: 363-418.

Mast, E.E. i Alter, M.J. Epidemiology of viral hepatitis: an overview. Seminars in Virology, 1993; 4: 273-283.

Mast, E.E. i Krawczynski, K. Hepatitis E: an overview. Annual Review of Medicine. 1996; 47: 257-266.

(13)

Mast, E.E., Alter, M.J., Holland, P.V i Purcell, R.H. Evaluation of assays for antibody to hepatitis E virus by a serum panel. Hepatitis E Virus Antibody Serum Panel Evaluation Group. Hepatology, 1998: 27: 857-861.

Mateos, L.M., Camarero, C., Lasa, E., Teruel, J.L., Mir, N. i Baquero, F. Hepatitis E virus: relevance in blood donors and risk groups. Vox Sanguinis, 1999; 76: 78-80.

Matsuda, H., Okada, K., Takahashi, K. i Mishiro, S. Severe hepatitis E virus infection after ingestion of uncooked liver from a wild boar. Journal of Infectious Disease, 2003; 188: 944.

McCaustland, K.A., Krawczynski, K., Ebert, J.W., Balayan, M.S., Andjaparidze, A.G., Spelbring, J.E., Cook, E.H., Humphrey, C., Yarbough, P.O., Favorov, M.O., Carson, D., Bradley, D.W. i Robertson, B.H. Hepatitis E virus infection in chimpanzees: a retrospective analysis. Archives of Virology, 2000; 145: 1909-1918.

McCrudden, R., O’Connell, S., Farrant, T., Beaton, S., Iredale, J.P. i Fine, D. Sporadic acute Hepatitis E in the United Kingdom: an underdiagnosed phenomenon? Gut, 2000; 46: 732-733.

Mechnik, L., Bergman, N., Attali, M., Beergabel, M., Mosenkis, B., Sokolowski. N. i Malnick S. Acute hepatitis E virus infection presenting as a prolonged cholestatic jaundice. Journal of Clinical Gastroenterology, 2001; 33 (5): 421–422.

Meng, X.J., Purcell, R.H., Halburg, P.G., Lehman, J.R., Webb, D.M., Tsareva, T.S., Haynes, J.S., Thacker, B.J. i Emerson, S.U. A novel virus in swine is closely related to the human hepatitis E virus. Proceedings of the National Academy of Science USA, 1997; 94: 9860-9865.

Meng, X.J., Halbur, P.G., Haynes, J.S., Tsareva, T.S., Bruna, J.D., Royer, R.L., Pucell, R.H. i Emerson, S.U. Experimental infection of pigs with the newly identified swine hepatitis E virus (swine HEV), but not with human strains of HEV. Archives of Virology,

1998a; 143: 1405-1415.

(14)

Meng, X.J., Dea, S., Engle, R.E., Friendship, R., Lyoo, Y.S., Sirinarumitr, T., Urairong, K., Wang, D., Wong, D., Yoo, D., Zhang, Y., Purcell, R.H. i Emerson, S.U. Prevalence of antibodies to the hepatitis E virus in pigs from countries where hepatitis E is common or is rare in the human population. Journal of Medical Virology, 1999; 59: 297-302.

Meng, J., Dai, X., Chang, J.C., Lopareva, E., Pillot, J., Fields, H.A. and Khudyakov. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus. Virology, 2001; 288: 203-211.

Meng, X.J., Wiseman, B., Elvinger, F., Guenette, D.K., Toth, T.E., Engle, R.E., Emerson S.U. i Purcell, R.H. Prevalence of antibodies to hepatitis E virus in veterinarians working with swine and in normal blood donors in the United States and other countries. Journal of Clinical Microbiology, 2002; 40 (1): 117-122.

Meng, X.J. Swine Hepatitis E virus: Cross-species infection and risk in xenotransplantation. Current Topics in Microbiology and Immunology, 2003; 278: 185-216.

Montella, F., Rezza, G., Di Sora, F., Pezzotti, P. i Recchia, O. Association between hepatitis E virus and HIV infection in homosexual men. Lancet, 1994; 19; 344 (8934):1433.

Nishizawa, T., Takahashi, M., Mizuo, H., Miyajima, H., Gotanda, Y. i Okamoto, H. Characterization of Japanese swine and human hepatitis E virus isolates of genotype IV with 99 % identity over the entire genome. Journal of General Virology, 2003; 84 (Pt 5):

1245-1251.

Nübling, M., Hofmman, F. i Tiller, F.W. Occupational risk for hepatitis A and hepatitis E among health care professionals. Infection, 2002; 30: 94-97.

Okamoto, H., Takahashi, M., Nishizawa, T., Fukai, K., Muramatsu, U. i Yoshikawa, A. Analysis of the complete genome of indigenous swine hepatitis E virus isolated in Japan. Biochemical and Biophysical Research Communications, 2001; 289: 929-936.

Paul, D.A., Knigge, M.F., Ritter, A., Gutierrez, R., Pilot-Matias, T., Chau, K.H. i Dawson, G.J. Determination of hepatitis E virus seroprevalence by using recombinant fusion proteins and synthetic peptides. Journal of Infectious Diseases, 1994; 169: 801-806.

(15)

Pei, Y. i Yoo, D. Genetic characterization and sequence heterogeneity of a canadian isolate of Swine hepatitis E virus. Journal of Clinical Microbiology, 2002; 40 (11): 4021-4029.

Pina, S., Puig, M., Lucena, F., Jofre, J. i Girones, R. Viral pollution in the environment and in shellfish: human adenovirus detection by PCR as an index of human viruses. Applied and Environmental Microbiology, 1998a; 64 (9): 3376-3382.

Pina, S., Jofre, J., Emerson, S.U., Purcell, R.H. i Girones, R. Characterization of a strain of infectious hepatitis E virus isolated from sewage in an area where hepatitis E is not endemic. Applied and Environmental Microbiology, 1998b; 64: 4485-4488.

Pina, S., Buti, M., Cotrina, M., Piella, J. i Girones, R. VHE identified in serum from humans with acute hepatitis and in sewage of animal origin in Spain. Journal of Hepatology,

2000; 33: 826-833.

Pina, S., Buti, M., Jardí, R., Clemente–Casares, P., Jofre, J. i Girones, R. Genetic analysis of the hepatitis A virus strains recovered from the environment and from acute hepatitis patients. Journal of General Virology, 2001; 82: 2955-2963.

Pringle, C.R. Virus Taxonomy – San Diego 1998. Archives of virology, 1998; 143: 1449-1459.

Psichogiou, M.A., Tassopoulus, N., Papatheodoridis, G.V., Tzala, E., Klarmann, R., Witteler, H., Schlauder, G.G., Troonen, H. i Hatzakis, A. Hepatitis E virus (HEV) infection in a cohort of patients with acute non-A, non-B hepatitis. Journal of Hepatology,

1995; 23: 668-673.

Psichogiou, M., Vaindirli, E., Tzala, E., Voudiclari, S., Boletis, J., Vosnidis, G., Moutafis, S., Skoutelis, G., Hadjiconstantinou, V., Troonen, H. i Hatzakis, A. Hepatitis E virus (HEV) infection in haemodialysis patients. The Multicentre Haemodialysis Cohort Study on Viral Hepatitis. Nephrology, Dialysis and Transplantation, 1996; 11 (6):

1093-1095.

(16)

Purcell, R.H. Hepatits E virus. In: Fields, B.N., Knipe, D.M., Howley, P.M., et al. (eds). Fields Virology. 3rd Edition. Vol 2. Lippincott-Raven Publishers, Philadelphia, 1996: 2831-2843.

Purcell, R.H., Emerson, S.U. Animals models of hepatitis A and E. ILAR Journal, 2001; 42 (2): 161-177.

Purcell, R.H., Nguyen, H., Shapiro, M., Engle, R.E., Govindarajan, S., Blackwelder, W.C., Wong, D.C., Prieels, J.P i emerson, S.U. Pre-clinical immunogenicity and efficacy trial of a recombinant hepatitis E vaccine. Vaccine, 2003; 21: 2607-2615.

Purdy, M.A., McCaustland, K.A., Krawczynski, K., Spelbring, J., Reyes, G.R., Bradley, D.W. Preliminary evidence that a trpE-HEV fusion protein protects cynomolgus macaques against challenge with wild-type hepatitis E virus (HEV). Journal of Medical Virology, 1993; 41 (1): 90-94.

Rab M.A., Bile, M.K., Mubarik, M.M., Asghar, H., Sami, Z. Siddiqi, S., Dil, A.S., Barzgar, M.A., Chaudry, M.A. i Burmey, M.I. Water-borne hepatitis E virus epidemic in Islamabad, Pakistan: a common source outbreak traced to the malfunction of a modern water treatment plant. American Journal of Tropical Medicine and Hygiene, 1997; 57: 151-157.

Ramachandran, J., Eapen, C.E., Kang, G., Abraham, P., Hubert, D., Kurian, G., Hephzibah, J., Mukhopadhya, A., i Chandy, G.M. Hepatitis E superinfection produces severe decompensation in patients with chronic liver disease. Journal of gastroenterology and Hepatology, 2004; 19: 134-138.

Rapicetta, M., Kondili, L.A., Pretolani, S., Stroffolini, T., Chionne, P., Villano, U., Madonna, E., Casali, F. i Gasbarrini, G. Seroprevalence and anti-HEV persistence in the general population of the Republic of San Marino. Journal of Medical Virology, 1999; 58: 49- 53.

Reyes, G.R., Purdy, M.A., Kim, J.P., Luk, K.C., Young, L.M., Fry, K.E. i Bradley, D.W. Isolation of cDNA from the virus responsible for enterically transmitted non-A, non-B. Science, 1990; 247: 1335-1339.

(17)

Robson, S. C., Adams, S., Brink, N., Woodruff, B. i Bradley, D. Hospital outbreak of hepatitis E. Lancet, 1992; 339: 1424-1425.

Schwartz, E., Jenks, N.P., Van Damme, P. i Galun, E. Hepatitis e virus infection in travelers. Clinical Infectious Diseases, 1999; 29: 1312-1314.

Schlauder, G.G., Dawson, G.J., Kwo, P.Y., Gabriel, G.S. i Mushahwar, I.K. Partial sequence comparison of a United States isolate of hepatitis E virus. IX Triennial International Symposium of Viral Hepatitis and Liver Diseases, 1996; A103: 78.

Schlauder, G.G., Dawson, G.J., Erker, J.C., Kwo, P.Y., Knigge, M.F., Smalley, D.L., Desai, S.M. i Mushahwar, I.K. The sequence and phylogenetic analysis of a novel hepatitis E virus isolated from a patient with acute hepatitis reported in the United States. Journal of General Virology, 1998; 79: 447-456.

Schlauder, G.S., Desai, S.M., Zanetti, A.R., Tassopoolos, N.C. i Mushahwar, I.K. Novel Hepatitis E virus (VHE) isolates from Europe: Evidence for aditional genotypes of VHE. Journal of Medical Virology, 1999; 57: 243-251.

Schlauder, G.G., Frider, B., Sookoin, S., Castano, G.C. i Mushahwar, I.K. Identification of two novel isolates of hepatitis E virus in Argentina. Journal of Infectious Diseases, 2000; 182: 294-297.

Schlauder, G.G. i Mushahwar I.K. Genetic heterogeneity of hepatitis E virus. Journal of Medical Virology, 2001: 65: 282-292.

Schofield, D.J., Glamann, J., Emerson, S.U. i Purcell, R.H. Identification by phage display and characterization of two neutralizing chimpanzee monoclonal antibodies to the hepatitis E virus capsid protein. Journal of Virology, 2000; 74 (12): 5548-5555.

Schofield, D.J., Purcell, R.H., Nguyen, H.T. and Emerson, S.U. Monoclonal antibodies that neutralize HEV recognize an antigenic site at the carboxyterminus of an ORF2 protein vaccine. Vaccine, 2003; 22: 257-267.

Seow, H.F., Mahomed, N.M., Mak, J.W., Riddell, M.A., Li, F. i Anderson, D.A. Seroprevalence of antibodies to hepatitis E virus in the normal blood donor population and two aboriginal communities in Malaysia. Journal of Medical Virology, 1999; 59: 164-168.

(18)

Sonada, H., Abe, M., Sugimoto, T., Sato, Y., Bando, M., Fukui, E., Mizuo, H., Takahashi, M., Nishizawa, T. i Okamoto, H. Prevalence of hepatitis E virus (HEV) infection in wild boars and deers and genetic identification of a genotype 3 HEV from a boar in Japan. Journal of Clinical Microbiology, 2004; 42 (11); 5371-5374.

Sun, Z.F., Larsen, C.T., Huang, F.F., Billam, P., Pierson, F.W., Toth, T.E. i Meng, X.J. Generation and infectivity titration of an infectious stock of avian hepatitis E virus (HEV) in chickens and cross-species infection of turkeys with avian HEV. Journal of Clinical Microbiology, 2004; 42 (6): 2658-2662.

Sylvan, S.P.E., Jacobson, S.H. i Christenson, B. Prevalence of antibodies to hepatitis E virus among hemodialysis patients in Sweden. Journal of Medical Virology, 1998; 54: 38-43.

Takahashi, M., Nishizawa, T., Miyahima, H., Gotanda, Y., Lita, T., Tsuda, F. i Okamoto, H. Swine hepatitis E virus strains in Japan form four phylogenetic clusters comparable with those of Japanese isolates of human hepatitis E virus. Journal of General Virology, 2003; 84: 851-862.

Tam, A.W., Smith, M.M., Guerra, M.E. Huang, C., Bradley, D.W., Fry, K.E. i Reyes, G.R. Hepatitis E virus (HEV): Molecular cloning and sequencing of the full-length viral genome. Virology, 1991; 185: 120-131.

Tam, A.W., White, R., Yarbough, P.O., Murphy, B.J., McAtee, C.P., Lanford, R.E. i Fuerst, T.R. In vitro infection and replication of hepatitis E virus in primary cynomolgus macaque hepatocytes. Virology, 1997; 238: 94-102.

Tassopoulos, N.C., Krawczynski, K., Hatzakis, A., Katsoulidou, A., Delladetsima, L., Koutelou, M.G. I Trichopoulos, D. Case report: role of hepatitis E virus in the etiology of community-acquired non-A, non-B hepatitis in Greece. Journal of Medical Virology 1994; 42: 124-128.

Tei, S., Kitajima, N., Takahashi, K. i Mishiro, S. Zoonotic transmission of hepatitis E virus from deer to human beings. Lancet, 2003; 362: 371-373.

(19)

Thomas, D.L., Yarbough, P.O., Vlahov, D., Tsarev, S.A, Nelson, K.E., Saah, A.J. i Purcell, R.H. Seroreactivity to hepatitis E virus in areas where the disease is not endemic. Journal of Clinical Microbiology, 1997; 35: 1244:1247.

Ticehurst, J.R. Hepatitis E virus. In: Murray P.R., Baron, E.J. Pfaller, M.A, Tenover, F.C. and Yolken, R.H. (eds). Manual of Clinical Microbiology, 7th edition. American Society for Microbiology Press, Washington DC, 1999: 1053-1069.

Tsarev, S.A., Emerson, S.U., Tsareva, T.S., Yarbough, P.O., Lewis, M., Govindarajan, S., Reyes, G.R., Shapiro, M. i Purcell R.H. Variation in course of hepatitis E in experimentally infected cynomolgus monkeys. Journal of Infectious Diseases,

1993a; 167: 1302-1306.

Tsarev S.A., Tsareva, T.S., Emerson S.U., Kapikian, A.Z., Ticehusrt, J., London, W. i Purcell, R.H. ELISA for antibody to hepatitis E virus (HEV) based on complete open reading frame-2 protein expressed in insect cells: identification of HEV infection in primates. Journal of Infectious Diseases, 1993b; 168: 369-378.

Tsarev, S.A., Tsareva, T.S., Emerson, S.U., Yarbouh, P.O., Legters, L.J., Moskal, T i Purcell, R.H. Infectivity titration of a prototype strain of hepatitis E virus in cynomolgus monkeys. Journal of Medical Virology, 1994a; 43: 135-142.

Tsarev, S.A., Tsareva, T.S., Emerson, S.U., Govindarajan, S., Shapiro, M., Gerin, J.L. i Purcell, R.H. Successful passive and active immunization of cynomolgus monkeys against hepatitis E. Proceedings of the National Academy of Science USA, 1994b; 91:

10198-10202.

Tsarev, S.A., Tsareva, T.S., Emerson, S.U., Rippy, M.K., Zach, P., Shapiro, M, i Purcell, R.H. Experimental hepatitis E in pregnant rhesus monkeys: failure to transmit hepatitis E virus (HEV) to offspring and evidence of naturally acquired antibodies to HEV. Journal of Infectious Diseases, 1995; 172: 31-37.

Tsarev, S.A., Tsareva, T.S., Emerson, S.U., Govindarajan, S., Shapiro, M., Gerin, J.L., Purcell, R.H. Recombinant vaccine against hepatitis E: dose response and protection against heterologous challenge. Vaccine, 1997;15: 1834-1838.

(20)

Usmanov, R.K., Balayan, M.S., Dvoinikova, O.V., Alybayeva, D.B., Zamiatina, N.A., Kazachkov, I.A. i Belov, V.I. An experimental infection in lambs by the hepatitis E virus. Voprosy Virusologii 1994; 39: 165-168.

Usui R., Kobayashi, E., Takahashi, M., Nishizawa, T. i Okamoto, H. Presence of antibodies to hepatitis E virus in Japanese pet cats. Infection, 2004; 32 (1): 57-58.

Vaidya, S.R., Chitambar, S.D. and Arankalle, V.A. Polymerase chain reaction-based prevalence of hepatitis A, hepatitis E and TT viruses in sewage from an endemic area. Journal of Hepatology, 2002; 37: 131-136.

Vaidya, S.R., Tilekar, B.N., Walimbe, A.M. i Arankalle, V.A. Increased risk of hepatitis E in sewage workers from India. Journal of Occupational and Environmental Medicine, 2003;

45: 1167-1170.

van der Poel, W.H., Vershoor, F., van der Heide, R., Herrera, M.I., Vivo, A., Kooreman, M., i de Roda Husman, A.M. Hepatitis e virus sequences in swine relates to sequences in humans, the Netherlands. Emerging Infection Diseases, 2001; 7: 970-976.

Velazquez, O., Stetler, H.C., Avila, C., Ornelas, G., Alvarez, C., Hadler, S.C., Bradley, D.W. i Sepulveda, J. Epidemic transmission of enterically transmitted non-A, non-B hepatitis in Mexico, 1986-1987. JAMA, 1990; 27; 263 (24): 3281-3285.

Viswanathan, R. Infectious hepatitis in Delhi (1955-56): A critical study: Epidemiology. Indian Journal of Medical Research, 1957; 45: 1-30.

Wang, Y.R., Ling, R., Erker, J.C., Zhang, H., Li, H., Desai, S.M., Mushahwar, I.K. i Harrison, T.J. A divergent Genotype of hepatitis E virus in Chinese patients with acute hepatitis. Journal of General Virology, 1999; 80: 169-177.

Wang, Y.R., Zhang, H., Ling, R., Li, H. i Harrison, T.J. The complete sequence of hepatitis E virus genotype 4 reveals an alternative strategy for translation of open reading frames 2 and 3. Journal of General Virology, 2000; 81: 1675-1686.

Wang, Y., Levine, D.F., Bendall, R.P., Teo, C.G. i HarrisonT.J. Partial sequence analysis of indigenous hepatitis E virus isolated in the United Kingdom. Journal of Medical Virology,

2001; 65: 706-709.

(21)

isolation, and partial sequence analysis of hepatitis E virus from domestic animals in China. Journal of Medical Virology, 2002; 67: 516-521.

Widdowson, M.A., Jaspers, W.J.M, van der Poel, W., Verschoor, F., de Roda Husman, A.M., Winter, H.L.J., Zaaijer, H.L. i Koopmans, N. Cluster of cases of acute hepatitis associated with hepatitis E virus infection acquired in The Netherlands. Clinical Infectious Diseases, 2003; 36: 29-33.

Wong, D.C., Purcell, R.H., Sreenivasan, M.A. Prasad, S.R. i Pavri, K.M. Epidemic and endemic hepatitis in India: evidence for non-A/non-B hepatitis virus etiology. Lancet, 1980; 2: 876-878.

Worm, H.C., Wurzer, H. i Frösner, G. Sporadic hepatitis E in Austria. New England Journal of Medicine, 1998; 339: 1554-1555.

Worm, H.C., Schlauder, G.G., Wurzer, H. i Mushahwar, I. Identification of a novel variant of hepatitis E virus in Austria: sequence, phylogenetic and serological analysis. Journal of General Virology, 2000; 81: 2885-2890.

Worm, H.C., van der Poel, W.H. i Brandstätter, G. Hepatitis E: an overview. Microbes and Infection, 2002a; 4: 657-666.

Worm, H.C., Schlauder, G.G. i Brandstätter, G. Hepatitis E and its emergence in non-endemic areas. Wien Klin Wochenschr, 2002b; 114/15-16: 663-670.

Worm, H.C. i Wirnsberger G. Hepatitis e vaccines: progress and prospects. Drugs, 2004; 64 (14): 1517-1531.

Yarbough, P.O., Tam, A.W., Fry, K.E., Krawczynski, K., McCaustland, K.A., Bradley, D.W. i Reyes, G.R. Hepatitis E virus: identification of type-common epitopes. Journal of Virology, 1991; 65: 5790-5797.

Yarbough, P.O. Hepatitis E virus: Advances in HEV biology and HEV vaccine approaches. Intervirology, 1999; 42: 179-184.

(22)

Zafrullah, M., Ozdener, M.H., Panda, S.K. i Jameel, S. The ORF3 protein of hepatitis E is a phosphoprotein that associates with the cytoskeleton. Journal of Virology, 1997; 71:

9045-9053.

Zafrullah, M., Ozdener, M.H., Kumar, R., Panda, S.K. i Jameel, S. Mutation analysis of glycosylation, membrane translocation, and cell surface expression of the hepatitis E virus ORF2 protein. Journal of Virology, 1999; 73: 4074-4082.

Zanetti, A.R., Dawson, G.J. i The Hepatitis Group. Hepatitis type E in Italy: a seroepidemiological survey. Journal of Medical Virology 1994; 42: 318-320.

(23)
(24)
(25)

A) Concentració de partícules víriques

Tampó glicina 0,25 M pH 9,5

9,383 g glicina

500 ml aigua destil·lada 1) Dissoldre amb agitació

2) Mesurar el pH i portar-lo a 9,5 afegint NaOH 3) Afegir aigua destil·lada fins a 500 ml

4) Autoclavar 20 min a 121ºC 5) Conservar a 4ºC

Tampó PBS pH 7,4 doble concentrat (2x)

16 g NaCl 0,4 g KCl 2,3 g Na2HPO4 0,4 g KH2PO4

1000 ml aigua destil·lada 1) Dissoldre les sals en l’aigua 2) Ajustar el pH a 7,4

3) Autoclavar a 121ºC durant 20 min 4) Conservar a 4ºC o a TA

Tampó PBS pH 7,4 (1x)

8 g NaCl 0,2 g KCl 1,15 g Na2HPO4 0,2 g KH2PO4

1000 ml aigua destil·lada 1) Dissoldre les sals en l’aigua 2) Ajustar el pH a 7,4

3) Autoclavar a 121ºC durant 20 min 4) Conservar a 4ºC o a TA

o alternativament

(26)

B) Extracció dels àcids nucleics

Partícules de sílice

3,6 g partícules de sílice 30 ml aigua destil·lada 36 µl HCl 32%

1) Autoclavar una probeta de 50 ml

2) Ressuspendre 3,6 g de partícules de sílice en 30 ml d’aigua destil·lada, tapar la probeta i agitar bé.

3) Deixar sedimentar les partícules de sílice durant 24h a TA. 4) Extreure 25,8 ml del sobrenedant.

5) Afegir fins a 30 ml d’aigua destil·lada i barrejar bé. 6) Deixar sedimentar 5 h a TA

7) Extreure 26,4 ml del sobrenedant

8) Ressuprende les partícules de sílice i passar 4ml a un tub de vidre amb tap 9) Afegir 36 µl de HCl 32%

10) Autoclavar a 121ºC durant 20 min

11) Ressuspendre les partícules de sílice i aliquotar-les en eppendorfs

12) Guardar a 4ºC a la foscor durant un màxim de 6 mesos

Tampó de lisi

6 g isotiocianat de guanidina 5 ml Tris-HCl 0,1M pH 6,4 1,1 ml EDTA 0,2M pH 8 125 µl Tritó X-100

1) Barrejat tot els components i homogeneïtzar-los amb l’ajuda d’un bany d’aigua a 55-60ºC

2) Conservar a TA a la foscor un màxim de 3 setmanes

* Manipular el isotiocianat de guanidina amb precaució. És tòxic.

Tampó de rentat

6 g isotiocianat de guanidina 5 ml Tris-HCl 0,1 M pH 6,4

(27)

2) Conservar a TA a la foscor un màxim de 3 setmanes

* Manipular el isotiocianat de guanidina amb precaució. És tòxic.

Tris-HCl 0,1 M pH 6,4

1,21 g Tris base

100 ml aigua bidestil·lada estèril 1) Dissoldre el Tris base en l’aigua 2) Ajustar el pH a 6,4 amb HCl 35% 3) Autoclavar a 121ºC durant 20 min

* Es recomana acabar d’enrasar a 100 ml finals un cop ajustat el pH

EDTA 0,2 M pH 8

7,44 g EDTA

100 ml aigua bidestil·lada

1) Dissoldre el Tris base en l’aigua 2) Ajustar el pH a 8 amb NaOH 1 N 3) Autoclavar a 121ºC durant 20 min

* Es recomana acabar d’enrasar a 100 ml finals un cop ajustat el pH

Etanol 70%

70 ml etanol absolut

30 ml aigua destil·lada estèril

Barrejar els components i conservar a -20ºC

Tampó Tris-EDTA (TE)

0,1211 g Tris 0,0037 g EDTA

100 ml aigua destil·lada estèril 1) Barrejar els components

2) Autoclavar a 121ºC durant 15 min 3) Guardar a TA

(28)

Tampó d’elució

49,6 µl DTT 1 mM 0,6 µl Inhibidor RNases

Barrejar els components i conservar a 4ºC

* Es recomana preparar el tampó d’elució durant la primera incubació a 55ºC

DTT 1 mM

1 µl DTT 1 M 1 ml TE

Barrejar i conservar congelat a -20ºC

DTT 1 M

0,0772 g DTT

0,5 ml acetat sòdic 0,01 M pH 5,2 1) Barrejar els components

2) Esterilitzar per filtració amb un filtre de 0,22 µm 3) Fer aliquotes de 50 µl

4) Mantenir congelat a -20ºC

Acetat sòdic 0,01 M pH 5,2

0,082 g acetat sòdic

100 ml aigua destil·lada estèril 1) Barrejar els components

2) Ajustar el pH a 5,2 amb àcid acètic glacial 3) Esterilitzar a l’autoclau 15 min a 121ºC

C) Amplificació de l’ARN víric i visualització

DTT 0,02 M

10 µl DTT 1 M 490 µl TE

(29)

TBE 10x

108 g Tris Base 9,3 g EDTA 55 g àcid bòric

aigua destil·lada fins a un litre 1) Barrejar els components 2) Autoclavar 15 min a 121ºC 3) Conservar a TA

* Es recomana afegir l’aigua al final per evitar vessaments.

TBE 1x

100 ml TBE 10x

900 ml aigua destil·lada

Barrejar els components i conservar a TA

Tampó de càrrega (gel coafenol 10x)

0,025g Blau de Bromofenol 2,5 g Ficoll-400

0,025 Xilen cianol

aigua destil·lada fins a 10 ml 1) Barrejar els components

2) Desfer els grumolls de Ficoll abans d’afegir tota l’aigua 3) Esterilitzar a l’autoclau durant 15 min a 121ºC

4) Mantenir a TA

* Es recomana començar enrasant una ampolla amb 10 ml d’aigua, marcar-la el volum i

buidar.

D) Transformació i creixement bacteria

̀

Medi SOC

2 g Bacto-Triptona

0,5 g Bacto-extracte de llevat 1 ml NaCl 1 M

(30)

1) Barrejar els components

2) Autoclavar a 121ºC durant 15 min 3) Afegir:

1ml Mg2+ 2 M 1ml glucosa 2 M 4) Ajustar el pH a 7 5) Conservar a 4ºC

NaCl 1 M

7,45 g NaCl

100 ml aigua destilada 1) Barrejar els components

2) Autoclavar a 121ºC durant 15 min 3) Conservar a temperatura ambient

KCl 1 M

5,85 g KCl

100 ml aigua destilada 1) Barrejar els components

2) Autoclavar a 121ºC durant 15 min

3) Conservar a temperatura ambient

Mg2+ 2 M

20,33 g MgCl2⋅6H2O 24,64 g MgSO4⋅7 H2O 100 ml aigua destil·lada 1) Barrejar els components

2) Filtrar amb filtres de 0,22 µm de porus 3) Conservar a temperatura ambient

Glucosa 2 M

30,032 g glucosa 100 ml aigua destil·lada 1) Barrejar els components

(31)

Medi Luria-Bertani líquid (LB) (segons el protocol del kit de clonació utilitzat)

10 g BactoTriptona

5 g Bacto Extracte de llevat

5 g NaCl

1 L aigua destil·lada 1) Barrejar els components 2) Ajustar el pH a 7

3) Autoclavar a 121ºC durant 15 min

Medi LB agar

10 g BactoTriptona

5 g Bacto Extracte de llevat 5 g NaCl

15 g agar

1 L aigua destil·lada 1) Barrejar els components 2) Ajustar el pH a 7

3) Autoclavar a 121ºC durant 15 min

4) Atemperar a 55ºC i dispensar en plaques de Petri 5) Conservar les plaques a 4ºC

X-gal (5-bromo-4-cloro-3-indolil-β-D-galactòsid) 0,01 g/ml

0,1 g X-gal

10 ml dimetilformamida

1) Barrejar els components en un tub de vidre 2) Cobrir per protegir de la llum i guardar a -20ºC

IPTG (isopropil- β-D-tiogalactòsid) 0,01 g/ml

0,1 g IPTG

10 ml aigua destil·lada 1) Barrejar els components

(32)

Ampicil·lina 0,1g/ml

0,1 g ampicil·lina 1 ml aigua bidestil·lada 1) Barrejar els components

2) Filtrar la solució amb un filtre de 0,22 µm de diàmetre 3) Guardar a -20ºC

Medi LB agar/ampicil·lina (100 µg/ml)

1) Preparar el medi LB i autoclavar-lo 2) Atemperar-lo a 55ºC

3) Afegir 1ml d’ampicil·lina 0,1 g/ml 4) Dispensar en plaques de Petri 5) Guardar a 4ºC

Medi LB líquid/ampicil·lina (100 µg/ml)

1) Preparar 0,5 L de medi LB i autoclavar-lo 2) Atemperar-lo a 55ºC

3) Afegir 0,5 ml d’ampicil·lina 0,1 g/ml 4) Dispensar 5 ml en tubs

5) Guardar a 4ºC o alternativament,

1) Preparar el medi LB i autoclavar-lo 2) Dispensar 5 ml en tubs

3) Afegir 5 µl d’ampicil·lina 0,1 g/l a cada tub 4) Guardar a 4ºC

Medi LB agar/ampicil·lina (100 µg/ml)/X-gal (80 µg/ml)/IPTG (0,5 mM)

1) Preparar 1 L de medi LB i autoclavar-lo 2) Atemperar-lo a 55ºC

3) Afegir 1ml d’ampicil·lina 0,1 g/ml, 8 ml X-gal 0,01 g/ml i 11,9 ml d’IPTG 0,1 g/ml 4) Dispensar en plaques de Petri

(33)

LB líquid/glicerol 30%/ampicil·lina 100 µg/ml

1) Preparar 70 ml de medi LB líquid 2) Afegir 30 ml de glicerol

3) Autoclavar a 121ºC durant 15 min 4) Afegir 100 µl d’ampicil·lina 0,1 g/ml 5) Conservar a 4ºC

Cl2Ca 50 mM

0,55 g Cl2Ca

100 ml aigua destil·lada 1) barrejar els components

2) Autoclavar a 121ºC durant 15 min 3) Conservar a 4ºC

Cl2Ca 50 mM/glicerol 15%

25 ml Cl2Ca 50 mM 3,75 ml glicerol

1) barrejar els components

2) Autoclavar a 121ºC durant 15 min 3) Conservar a 4ºC

E) Expressió de proteïnes i RIPA

Tampó de carrera Tris-Glicina-SDS (10x)

30 g Tris base 144 g glicina 10 g SDS

1 L d’aigua destil·lada 1) Barrejar els components

2) Conservar a temperatura ambient

Tampó de carrera Tris-Glicina-SDS (1x)

(34)

Tampó RIPA desnaturalitzant (tampó 2x)

10 ml Tris 0,1 M pH 7,4 6 ml NaCl 5 M

20 ml SDS 10% 2 ml Triton X 100 2 g àcid deoxicòlic

1) Barrejar els components

2) Ajustar fins a 100 ml amb aigua destil·lada 3) Conservar a temperatura ambient

Solució de fixació

100 ml àcid acètic 100 ml metanol 800 ml aigua

1) Barrejar els components

(35)
(36)
(37)

1. La metodologia utilitzada és altament sensible i permet obtenir informació sobre la presència del VHE en aigua residual i altres tipus de mostres ambientals, com biosòlids. A més, facilita el desenvolupament d’estudis genètics amb virus que no poden ser cultivats al laboratori.

2. S’ha detectat la presència del VHE en aigua residual urbana de Barcelona, amb més d’un 50% de mostres positives, i d’altres àrees també considerades no-endèmiques pel virus, coincidint aquestes amb les localitzacions amb un major percentatge de mostres positives pel VHA. Aquests alts nivells d’excreció del VHE indiquen una prevalença d’infecció pel virus superior a l’esperada en regions considerades no-endèmiques.

3. Diferents soques del VHE circulen simultàniament en poblacions prèviament considerades no endèmiques, pertanyent la gran majoria d’elles al genotip 3, típic d’aquestes regions. Les soques detectades a Barcelona són molt similars entre elles i a soques d’origen europeu.

4. La diversitat genètica de les soques del VHE aïllades a l’aigua residual de Barcelona permet descartar l’existència d’un únic brot i demostren l’existència d’infeccions subclíniques endèmiques en la població.

5. No s’ha detectat bioacumulació del VHE en els mol·luscs bivalves analitzats i que presentaven contaminació per altres virus també excretats, probablement per les baixes concentracions del virus en les aigües residuals i/o per una menor estabilitat del virus en aigua de mar o a l’interior dels organismes filtradors.

6. S’han identificat a Barcelona casos clínics d’hepatitis E causades per soques del VHE autòctones. Aquest tipus d’hepatitis aguda es considera actualment una infecció emergent en països industrialitzats. Les soques causants dels casos clínics detectats pertanyen al genotip 3 i són molt similars a les soques aïllades a partir de mostres d’aigua residual urbana (fins a un 100% en el fragment comparat). També es detecten, en menor proporció, infeccions causades per soques importades durant viatges a regions endèmiques.

7. Les mostres de sèrum analitzades en un grup de veterinaris no presentaven nivells de seroprevalença significativament superiors als de la població general, encara que per obtenir conclusions definitives és necessari analitzar un nombre més gran de mostres.

(38)

infeccions amb un únic increment de les IgG anti-VHE durant la fase aguda i disminució posterior.

9. La resposta humoral generada contra el VHE (IgG anti-VHE) té una durada variable. En alguns pacients els nivells d’IgG anti-VHE eren indectectables entre 2 i 8 mesos després de la primera presa de mostra durant la infecció. En un cas els nivells eren detectables gairebé 12 anys després de la infecció.

10. Estudis d’infectivitat en micos rhesus han mostrat que la soca VH4 autòctona de Barcelona i causant d’hepatitis aguda en humans també infecta aquest model animal. No va causar alteracions bioquímiques ni símptomes de la malaltia en els animals, però sí seroconversió, virèmia i excreció del virus en femta.

11. El VHE infecta de manera natural poblacions porcines. Les soques porcines identificades tant a partir de femta porcina com de biosòlids d’escorxador són més similars a les soques humanes de la mateixa àrea que a les soques porcines d’altres regions. Pertanyen al genotip 3.

12. S’ha detectat el virus en porcs de diferents grups d’edat, essent l’excreció major en animals de 8 setmanes d’edat. La seroprevalença incrementa amb l’edat, no detectant IgG anti-VHE en animals de menys de 10 setmanes. Els reservoris del virus en la granja podrien ser les truges, virològica i serològicament positives.

13. La seroprevalença observada en el conjunt de les 3 granges estudiades (13,7%) i juntament amb un estudi previ a on s’analitzaren 6 granges més (18,8%) són inferiors a les detectades en d’altres països industrialitzats com E.U.A o Japó.

14. En l’estudi preliminar realitzat no ha estat possible la detecció de cap soca del VHE d’origen boví, malgrat que s’ha descrit en diferents estudis la presència d’IgG anti-VHE en aquests animals.

15. S’ha dissenyat un protocol per introduir mutacions en el genoma del VHE i estudiar el seu efecte en l’antigenicitat mitjançant una tècnica in vitro. L’ús d’aquest tipus de tècniques,

però, pot generar resultats diferents als obtinguts mitjançant l’ús de tècniques in vivo.

(39)
(40)
(41)

Capítol 5. Estudis de l’antigenicitat de

(42)
(43)

5.1.

INTRODUCCIÓ I OBJECTIUS

El VHE és la principal causa d’hepatitis agudes en països subdesenvolupats, però no

existeix fins al moment cap vacuna disponible. La incapacitat de fer créixer el VHE en cultiu

cel·lular i el baix títol de partícules víriques excretades en femta no han permès una bona

caracterització bioquímica del virus. Mitjançant tècniques moleculars s’han identificat 4 grans

genotips i un únic serotip. Els únics models disponibles per estudiar la resposta contra el VHE

són models animals, principalment el primats no-humans com ximpanzés i macacs. Tsarev i

col (1994b) van dissenyar una vacuna recombinant consistent en una forma truncada de la

proteïna de la càpside que va estimular en macacs una resposta humoral protectora contra

la infecció per soques del mateix genotip (genotip 1) i d’altres (genotips 2 i 3). Altres

investigadors van observar que la inoculació de sèrum anti-VHE provinent d’un animal

convalescent d’una infecció per VHE disminuïa considerablement l’excreció del virus en femta

i evitava la malaltia per infecció amb una soca homòloga. Aquests resultats suggereixen que

preparats d’immunoglobulines similars als utilitzats pel VHA, podrien protegir contra la

infecció pel VHE.

L’epítop neutralitzant del genoma del VHE descrit fins ara està codificat per la regió

ORF2. Es troba localitzat cap a l’extrem C-terminal de la proteïna de la càpside. Meng i col.

(2001) determinaren que el fragment mínim de la proteïna de la càpside del VHE que pot

modelar eficaçment l’epítop neutralitzant té una longitud de 166 aa, i està localitzat entre els

aa 452 i 617 de la soca birmana. Schofield i col (2000), mitjançant l’ús d’una llibreria fàgica

d’anticossos van demostrar que l’epítop neutralitzant estava localitzat entre els aa 578 i 607

de la soca pakistaní. Partint d’aquesta llibreria fàgica d’ADNc dels gens γ1/κ derivada dels limfòcits de la mèdul·la òsea d’un ximpanzé (Pan troglodytes) inoculat amb la soca Sar55,

identificaren anticossos que reaccionaven contra diferents regions de la proteïna de l’ORF2.

Uns anticossos reaccionaven amb l’extrem C-terminal de la proteïna, a la regió identificada

com a essencial per l’activitat neutralitzant. Estudis de neutralització amb 2 d’aquests

anticossos mostraren que eren neutralitzants.

Meng i col. (2001) van descriure que anticossos induïts per un fragment que contenia

els aa 452 a 617 de l’ORF2 del genoma d’una soca birmana neutralitzaven soques dels

genotips 1, 2 i 3, indicant l’existència, en aquesta regió, d’epítops compartits per les

diferents soques. Els estudis realitzats per Schofield i col. (2000 i 2003) per analitzar el

comportament dels anticossos obtinguts contra Sar55 davant altres soques (la soca Mex14 i

(44)

diferències. Gairebé tots els anticossos s’unien a la soca Meng amb la mateixa intensitat que

a la soca Sar55. Alguns, però, no van reconèixer la soca Mex14 del genotip 2.

Per avaluar l’efecte sobre l’antigenicitat dels canvis puntuals observats a la seqüència

d’aa de les soques del VHE es va seleccionar la regió que contenia l’epítop neutralitzant i es

van dissenyar una sèrie d’experiments. Aquests experiments es van realitzar durant una

estada al Laboratory of Infectious Diseases (LID) del National Institute of Allergy and

Infectious Diseases (NIAID) dels National Institutes of Health (NIH), sota la direcció del Dr.

Robert Purcell i la Dra. Sue Emerson. Primer es determinaren quines posicions

aminoacídiques del fragment comprès entre els aa 449 i 607 de l’ORF2 de la soca Sar55 eren

diferents entre aquesta i Mex14, i després es compararen aquestes posicions amb la soca

porcina Meng. Es van seleccionar les posicions amb diferent aa a Sar55 i Mex14 sempre que

aquest aa també fos diferent entre Mex14 i Meng. En total es van seleccionar 6 posicions a

incloure a l’estudi. Per PCR recombinant es van canviar els aa seleccionats de Sar55 pels

presents a Mex14. La introducció de les mutacions, expressió dels pèptids mutats i estudis

de radioimmunoprecipitació es descriuen en aquest capítol.

Els resultats obtinguts són preliminars i estan essent complementats amb nous

experiments al LID.

Els objectius d’aquest capítol de la tesi van ser:

” Dissenyar un protocol per modificar el genoma de la soca Sar55 del VHE per

mutagènesi dirigida i expressió in vitro dels pèptids mutats

” Estudiar el comportament d’anticossos anti-Sar55 en front a pèptids mutats

(45)

5.2.

MATERIALS I MÈTODES

5.2.1.

Disseny d’encebadors

La introducció de mutacions puntuals es pot aconseguir mitjançant el disseny i

posterior ús a la PCR d’encebadors que continguin la mutació desitjada.

Els aa que es van canviar estan marcats a la Figures 5.1. La comparació de les

seqüències d’aa de les soques Sar55, Mex14 i Meng va permetre seleccionar 6 posicions a

estudiar per determinar si alguna d’elles era la causant de la diferència de reconeixement

observada en els experiments realitzats per Schofield i col. (2003) al enfrontar Ac contra

Sar55 amb la soca Mex14.

A més de les mutacions necessàries per provocar canvis d’aminoàcids a la seqüència

de Sar55 també es van introduir mutacions que permetien generar un primer codó d’inici de

la traducció i un codó stop final. Els fragments de seqüència de Sar55 mutats, un cop clonats

i traduïts, generaven pèptids amb l’epítop neutralitzant complet i aminoàcids de Mex14 en

posicions determinades.

Els experiments es van realitzar amb 2 controls: els pèptids derivats de les seqüències

sense modificar de Sar55 i de Mex14. L’obtenció d’ambdós pèptids únicament va requerir la

introducció dels codons d’inici i stop.

Les mutacions puntuals introduïdes a Sar55 van ser:

Æ Mutació 1 (M1): Canvi de V (GTC) a I (ATC)

Æ Mutació 2 (M2): Canvi de T (ACC) a S (TCC)

Æ Mutació 3 (M3): Canvi de S (TCC) a P (CCC)

Canvi de I (ATC) a V (GTC)

Canvi de Q (CAG) a E (GAG)

(46)

Estudi

s de l’anti

genici tat de l’epí top neut ralitzant del VHE. Sar-55 : Mex-14 : * 20 * 40 * 60 * 80 * EQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLSTIQQYSKTFFVLPLR ...I...S...P.VE...

: 95 : 95 Sar-55 : Mex-14 : 100 * 120 * 140 * 160 GKLSFWEAGTTKAGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAVLAPHSVLA ...I.I...R...A...A...R.A.. : 161 : 161 Sar-55 : Mex-14 : GAGCAGGACCGACCGACACCTTCCCCAGCCCCATCGCGTCCTTTTTCTGTCCTCCGAGCTAACGATGTGCTTTGGCTTTCTCTCACCGCTGCCGAGT ...T..G..C..C..G..G..T..G...T..G...T...A..T...A...G..C...T..A...

: 97 : 97 Sar-55 : Mex-14 : 100 * 120 * 140 * 160 * 180 * ATGACCAGTCCACTTACGGCTCTTCGACCGGCCCAGTCTATGTCTCTGACTCTGTGACCTTGGTTAATGTTGCGACCGGCGCGCAGGCCGTTGCCCG ...G..G..A..T...G..T...A....G...AGC...T...G...T...A... : 194 : 194 Sar-55 : Mex-14 : 200 * 220 * 240 * 260 * 280 * GTCACTCGACTGGACCAAGGTCACACTTGATGGTCGCCCCCTTTCCACCATCCAGCAGTATTCAAAGACCTTCTTTGTCCTGCCGCTCCGCGGTAAG A..G..T...T....A...C..C..C..G..G...CC.G..TG.TG....A...C...A...G..C..C..T..T..C... : 291 : 291 Sar-55 : Mex-14 : 300 * 320 * 340 * 360 * 380 CTCTCCTTTTGGGAGGCAGGAACTACTAAAGCCGGGTACCCTTATAATTATAACACCACTGCTAGTGACCAACTGCTCGTTGAGAATGCCGCTGGGC ...C..C..A..A...A..T..T...T..T...GA.T..GA....A...T..C..C. : 388 : 388 Sar-55 : Mex-14 : * 400 * 420 * 440 * 460 * 480 ATCGGGTTGCTATTTCCACCTACACTACTAGCCTGGGTGCTGGCCCCGTCTCTATTTCCGCGGTTGCTGTTTTAGCCCCCCACTCTGTGCTAGCA ...C..C...A...T..C..C..G..T..G..C..T..G...G.C...T....CC..G...G..T..A.G...C.CC..G..T : 483 : 483

Figura 5.1. Seqüències nucleotídica i aminoacídica de la regió de l’ORF2 continguda entre els nt 6461 i 6937 de la soca Sar55 (A) i els nt 6458 i 6934 de la soca Mex14 (B). Els aa encerclats són els que van ser modificats a la seqüència de Sar55

A)

(47)

Els encebadors necessaris per la introducció dels codó d’inici i stop de la traducció a la

seqüència de Sar55 van ser cedits per Yi-Huas Zhou del LID. Tots els altres encebadors es

van dissenyar comparant les seqüències de Sar55 i Mex14 (Taula 5.1.).

Taula 5.1. Encebadors utilitzats per la modificació de les soques Sar55 i Mex14.

Mutació Encebador Reacció T.a. Seqüència (5’→3’)

Sar55-N449F ATGCAGGACCGACCGACACCTT

Sar55-M517R

1a PCR 58

CCTTGGACCAGTCGAGTGACCGG

Sar55-M517F GTTGCCCGGTCACTCGACTGGTCCAAGG M1

Sar55-607R

PCR niada 60

CTATAGCACAGAGTGGGGGGCTA

Sar55-N449F ATGCAGGACCGACCGACACCTT

Sar55-494R

1a PCR 60

GTCAGAGATATAGACTGGGCCGG

Sar55-M494F TTCGACCGGCCCAGTCTATATCTCTGAC M2

Sar55-607R

PCR niada 59

CTATAGCACAGAGTGGGGGGCTA

Sar55-N449F ATGCAGGACCGACCGACACCTT

Sar55-3M527R

1a PCR 60

ACTGCTCGACGGTGGGAAGGGGG

Sar55-3M527F GGTCGCCCCCTTCCCACCGTCGAGCAGT

M3

Sar55-607R

PCR niada 59

CTATAGCACAGAGTGGGGGGCTA Sar55-N449F ATGCAGGACCGACCGACACCTT M4 Sar55-M604R PCR 60 CTATAGCACAGAGCGGGGGGCTA HEV DGN

6300-6320F 1a PCR 45 ACAGAATTAATTTCGTCGGCT

MZ 7894 RV RT 42 GATAAGCTTGATATCAGATCTTTTTTTTTTTTTTTTCAGG

Mex-448F ATGCAGGATCGGCCCACCCCGT Mex14

Mex-606R

PCR

seminiada 63 CTACAGGGCGGAGCGTGGAGCCA

T.a.= temperatura d’anellament

5.2.2.

Soques de referència: Sar55 i Mex14

Per realitzar els estudis d’antigenicitat amb la soca pakistaní Sar55 es va partir del clon

pSK-HEV-2. Aquest és un clon que conté el genoma complet de la soca en forma d’ADN. Es

(48)

Els estudis amb la soca Mex14 s’iniciaren a partir d’una extracció d’àcids nucleics

cedida per Hanh Nguyen del LID.

5.2.3.

Mutagènesi dirigida

La PCR recombinant permet la introducció de mutacions a un fragment d’ADN

mitjançant l’ús d’encebadors que contenen la mutació. Es composa de dues PCR inicials que

introdueixen la mutació desitjada mitjançant els encebadors dissenyats amb la mutació. En

aquest moment la mutació es troba a un dels extrems dels fragments amplificats.

Posteriorment es realitza la PCR recombinant que permet, per aparellament de la regió

mutada, la combinació dels fragments obtinguts a les PCR inicials per generar un únic

amplicó que ja conté la mutació introduïda a la posició desitjada (Figura 5.2.).

Figura 5.2. Esquema de la introducció de mutacions puntuals mitjançant PCR recombinant o de fusió.

PCR1: s’introdueix el codó ATG inicial i la mutació

PCR2: s’introdueix el codó stop i la mutació

PCR recombinant o de

fusió: s’obté la

seqüència completa mutada i preparada per ser traduïda

ADN motlle

Encebador amb el codó d’inici de la traducció

Encebador amb el codó STOP

Encebador amb la mutació puntual PCR1: s’introdueix el codó ATG inicial i la mutació

PCR2: s’introdueix el codó stop i la mutació

PCR recombinant o de

fusió: s’obté la

seqüència completa mutada i preparada per ser traduïda

ADN motlle

Encebador amb el codó d’inici de la traducció

Encebador amb el codó STOP

(49)

5.2.3.1.

Mutació 1, Mutació 2 i Mutació 3

5.2.3.1.1.

PCR mutagèniques (PCR1 i PCR2)

Cada mutació introduïda requeria 2 PCR inicials amb encebadors diferents:

⇒ PCR1: amb l’encebador directe que contenia el codó d’inici de la traducció i el revers que contenia la mutació puntual.

⇒ PCR2: amb l’encebador directe que contenia la mutació puntual i el revers que contenia el codó STOP.

Per la mutació 1 (M1) es van fer 2 rèpliques de cada PCR inicial amb 2 µl de plàsmid

pSK-HEV-2, mentre que per les mutacions 2 (M2) i 3 (M3) es van fer 4 rèpliques amb 5 µl de

plàsmid. Aquestes PCR es van realitzar de la següent manera:

ƒPreparar les barreges necessàries per les PCR inicials en una zona neta (Taula 5.2.).

Taula 5.2. Components necessaris per les reaccions de PCR mutagènica.

PCR Quantitat Concentració final per 50 µl

10 x Pfx Buffer 5 µl 1x

50 mM MgSO4 1 µl 1 mM

10mM dNTP 1 µl 0,2 mM

Encebador directe 10 µM 1 µl 0,2 µM

Encebador revers 10 µM 1 µl 0,2 µM

Polimerasa Pfx 5 U/µl 0,5 µl 2,5 U

H2O destil·lada estèril Fins a un total de 50µl -

ƒDistribuir la barreja en tubs de 0,2 ml adequadament marcats.

ƒAfegir la quantitat de plàsmid desitjat (2 µl per M1 i 5µl per M2 i M3) al laboratori.

ƒCentrifugar uns segons per baixar tot al fons del tub.

ƒAfegir 50 µl d’oli mineral.

(50)

¾ 5 min a 94ºC

¾ 45 seg a 94ºC

¾ 45 seg a T. anellament 35 cicles

¾ 1 min a 72ºC

¾ 10 min a 72ºC

¾ 4ºC

ƒAnalitzar en un gel d’agarosa Seakem al 1,5% amb tinció de bromur d’etidi.

Les temperatures d’anellament dels diferents encebadors estan descrites a la Taula

5.1.

5.2.3.1.2.

Purificació dels productes de les PCR mutagèniques

Els productes de les PCR inicials es purificaven 2 cops. El primer cop es feia una

purificació directa a partir dels tubs de PCR tal i com es descriu a l’apartat 2.2.1.5.1.1., amb

un pas previ per eliminar l’oli vegetal sense perill de perdre mostra. Això s’aconseguia

congelant els productes de PCR i succionant amb una pipeta l’oli vegetal. Les diferents

rèpliques de cada PCR es purificaven amb la mateixa columna. Repetint el primer pas de la

purificació tants cops com rèpliques hi havia. Tot el producte final s’eluïa en 30 µl del tampó

d’elució subministrat amb el kit i es mantenia a -20ºC.

Per tal de separar l’ADN amplificat (amb mutació) de l’ADN del clon (sense mutació) i

evitar l’amplificació d’aquest segon a la PCR recombinant, es feia un segon pas de purificació

a partir de gel. El kit utilitzat va ser el QIAquick gel extraction Kit però amb columnes del kit

MinElute PCR Purification Kit (QIAGEN), que permeten concentrar tot l’ADN en 10 µl finals. El

protocol era el descrit a l’apartat 2.2.1.5.1.2. amb lleugeres variacions. Els 30 µl de purificat

es carregaven en un gel al 1,5% d’agarosa Seakem i es deixava córrer a uns 90 V durant 45

min. Les bandes desitjades es tallaven amb llancetes. S’utilitzava una llanceta per cada

banda. El producte final l’eluia amb 10 µl de tampó BE. Un cop realitzada la purificació, es

corria un gel amb 4 µl del purificat per comprovar que s’havia recuperat l’ADN desitjat. El

(51)

5.2.3.1.3.

PCR recombinant o de fusió

La PCR recombinant es realitzava a partir dels amplificats obtinguts a les PCR inicials

amb les que s’havia introduït la mutació desitjada. Aquest tipus de PCR permetia l’obtenció

del fragment complet de l’epítop neutralitzant mutat.

Per realitzar la PCR recombinant es van barrejar en un sol tub 3 µl (per M1) i 1 µl (per

M2 i M3) dels 2 productes de PCR purificats a partir de gel de les PCR inicials corresponents

a cada mutació, afegint els encebadors més externs del fragment, que contenien el codó

d’inici de la traducció i el codó STOP. La barreja de PCR correspon a la descrita a la Taula

5.2., ajustant la quantitat d’aigua en funció de l’ADN afegit. La temperatura d’anellament de

totes les PCR recombinants va ser de 60ºC. Les condicions eren:

¾ 5 min a 94ºC

¾ 45 seg a 94ºC

¾ 45 seg a 60ºC 35 cicles

¾ 1 min a 72ºC

¾ 10 min a 72ºC

¾ 4ºC

A l’igual que els productes de les PCR1 i PCR2, els productes de les PCR recombinants

van ser purificats. Una primera purificació es realitzà amb el kit QIAquick PCR Purification Kit

de QIAGEN eluint amb 30 µl de buffer d’elució i posteriorment a partir d’un gel d’agarosa

amb el kit QIAquick Gel Extraction kit i columnes MinElute, eluint amb 10 µl de tampó

d’elució. El purificat es va mantenir congelat a -20ºC.

5.2.3.2.

Mutació 4

La mutació 4 (M4) es troba a l’extrem 3’ del fragment que comprèn l’epítop

neutralitzant. La barreja de PCR utilitzada per introduir aquesta mutació està descrita a la

Taula 5.2. En aquest cas es va realitzar una única PCR amb 5 µl de plàsmid que generava tot

el fragment de l’epítop neutralitzant amb el canvi d’aminoàcid a l’extrem 3’ i els codons d’inici

i STOP de la traducció.

Figure

Figura 5.1. Seqüències nucleotídica i aminoacídica de la regió de l’ORF2 continguda entre els nt 6461 i 6937 de la soca  Sar55 (A) i els nt 6458 i 6934 de la soca Mex14 (B)

Figura 5.1.

Seqüències nucleotídica i aminoacídica de la regió de l’ORF2 continguda entre els nt 6461 i 6937 de la soca Sar55 (A) i els nt 6458 i 6934 de la soca Mex14 (B) p.46
Figura 5.2. Esquema de la introducció de mutacions puntuals mitjançant PCR recombinant o de fusió

Figura 5.2.

Esquema de la introducció de mutacions puntuals mitjançant PCR recombinant o de fusió p.48
Figura 5.3. Estructura del vector pGEM-T (Promega).

Figura 5.3.

Estructura del vector pGEM-T (Promega). p.55
Figura 5.4. Esquema de la situació de les diferents dianes de restricció si l’insert s’havia lligat en direcció SP6→T7

Figura 5.4.

Esquema de la situació de les diferents dianes de restricció si l’insert s’havia lligat en direcció SP6→T7 p.59
Figura 5.5. Esquema de la situació de les diferents dianes de restricció si l’insert s’havia lligat en direcció T7→SP6

Figura 5.5.

Esquema de la situació de les diferents dianes de restricció si l’insert s’havia lligat en direcció T7→SP6 p.59
Figura 5.6. Esquema del procés de radioimmunoprecipitació (RIPA).

Figura 5.6.

Esquema del procés de radioimmunoprecipitació (RIPA). p.66
Figura 5.7. Alineament de les seqüències mutades de nucleòtids (M1, M2, M3 i M4) així com de Sar55 i Mex14

Figura 5.7.

Alineament de les seqüències mutades de nucleòtids (M1, M2, M3 i M4) així com de Sar55 i Mex14 p.70
Figura 5.7. Alineament de les seqüències mutades d’aa de M1, M2, M3 i M4, així com de Sar55 i Mex14

Figura 5.7.

Alineament de les seqüències mutades d’aa de M1, M2, M3 i M4, així com de Sar55 i Mex14 p.71
Figura 5.9. Resultats dels assajos RIPA amb els diferents pèptids. A) Pèptids de les soques salvatges Sar55 i Mex14 enfront als 4 Ac que reaccionen davant l’epítop neutralitzant de Sar55

Figura 5.9.

Resultats dels assajos RIPA amb els diferents pèptids. A) Pèptids de les soques salvatges Sar55 i Mex14 enfront als 4 Ac que reaccionen davant l’epítop neutralitzant de Sar55 p.73
Figura 4.1. Alineament de les seqüències d’aminoàcids de la regió de l’ORF1 amplificada de les soques d’origen porcí aïllades a Barcelona, altres d’origen humà de la mateixa àrea i soques representants dels diferents genotips

Figura 4.1.

Alineament de les seqüències d’aminoàcids de la regió de l’ORF1 amplificada de les soques d’origen porcí aïllades a Barcelona, altres d’origen humà de la mateixa àrea i soques representants dels diferents genotips p.96
Figura 4.2. Arbres obtinguts pel mètode Neighbor Joining representant les relacions filogenètiques segons els fragments de 101 nt amplificats de la regió de l’ORF2 (A) i de 242 nt de la regió de l’ORF1 (B) entre les seqüències porcines aïllades a Barcelona

Figura 4.2.

Arbres obtinguts pel mètode Neighbor Joining representant les relacions filogenètiques segons els fragments de 101 nt amplificats de la regió de l’ORF2 (A) i de 242 nt de la regió de l’ORF1 (B) entre les seqüències porcines aïllades a Barcelona p.97
Figura 4.3. Arbre obtingut pel mètode Neighbor Joining representant les relacions filogenètiques segons el fragment de 98 nt amplificat de la regió de l’ORF2 entre les seqüències obtingudes a partir dels llots d’escorxador i altres soques porcines represen

Figura 4.3.

Arbre obtingut pel mètode Neighbor Joining representant les relacions filogenètiques segons el fragment de 98 nt amplificat de la regió de l’ORF2 entre les seqüències obtingudes a partir dels llots d’escorxador i altres soques porcines represen p.99
Figura 4.4. Arbre obtingut pel mètode Neighbor Joining representant les relacions filogenètiques segons el fragment de 98 nt amplificat de la regió de l’ORF2 entre d’aigua residual urbana, femta porcina i llots d’escorxador) i altres soques d’origen humà i

Figura 4.4.

Arbre obtingut pel mètode Neighbor Joining representant les relacions filogenètiques segons el fragment de 98 nt amplificat de la regió de l’ORF2 entre d’aigua residual urbana, femta porcina i llots d’escorxador) i altres soques d’origen humà i p.100
Figura 3.1. Arbre creat pel mètode Neighbor Joining representant les relacions filogenètiques segons el fragment de 101 nt amplificat de la regió de l’ORF2 entre les soques causants d’hepatitis agudes a Barcelona i altres soques representants dels diferent

Figura 3.1.

Arbre creat pel mètode Neighbor Joining representant les relacions filogenètiques segons el fragment de 101 nt amplificat de la regió de l’ORF2 entre les soques causants d’hepatitis agudes a Barcelona i altres soques representants dels diferent p.128
Figura 3.2. Comparació de les seqüències d’aminoàcids del fragment de la regió de l’ORF2 amplificat de les soques aïllades a Barcelona i altres presents als bancs de dades i representants dels 4 grans genotips

Figura 3.2.

Comparació de les seqüències d’aminoàcids del fragment de la regió de l’ORF2 amplificat de les soques aïllades a Barcelona i altres presents als bancs de dades i representants dels 4 grans genotips p.129
Figura 3.2. Arbre creat pel mètode Neighbor Joining representant les relacions filogenètiques segons el fragment de 242 nt amplificat de la regió de l’ORF1 entre les soques causants d’hepatitis agudes a Barcelona i altres soques representants dels diferent

Figura 3.2.

Arbre creat pel mètode Neighbor Joining representant les relacions filogenètiques segons el fragment de 242 nt amplificat de la regió de l’ORF1 entre les soques causants d’hepatitis agudes a Barcelona i altres soques representants dels diferent p.132
Figura 3.3. Comparació de les seqüències d’aminoàcids de les soques clíniques aïllades a Barcelona i altres presents als bancs de dades i representants dels 4 grans genotips

Figura 3.3.

Comparació de les seqüències d’aminoàcids de les soques clíniques aïllades a Barcelona i altres presents als bancs de dades i representants dels 4 grans genotips p.133
Figura 3.4. Seguiment bioquímic (ALT, ICD i GGTP), serològic (IgG anti-VHE) i virològic (ARN del VHE) de la infecció produïda per la soca clínica VH4 en 2 micos inoculats (A) i (B)

Figura 3.4.

Seguiment bioquímic (ALT, ICD i GGTP), serològic (IgG anti-VHE) i virològic (ARN del VHE) de la infecció produïda per la soca clínica VH4 en 2 micos inoculats (A) i (B) p.137
Figura 2.1. Estructura del vector pGEM-T easy (Promega).

Figura 2.1.

Estructura del vector pGEM-T easy (Promega). p.167
Figura 2.2. Amplificació per RT-PCR niada amb diferents iniciadors de la soca BCN utilitzada com a control positiu

Figura 2.2.

Amplificació per RT-PCR niada amb diferents iniciadors de la soca BCN utilitzada com a control positiu p.173
Figura 2.4. Alineament de les seqüències aïllades a partir de 10 clons de la mostra SA 4/01 i de les 2 seqüències obtingudes a partir de la seqüènciació directa del producte

Figura 2.4.

Alineament de les seqüències aïllades a partir de 10 clons de la mostra SA 4/01 i de les 2 seqüències obtingudes a partir de la seqüènciació directa del producte p.179
Figura 2.5. Alineament de les seqüències aïllades a partir dels 10 clons de la mostra SA 5/03

Figura 2.5.

Alineament de les seqüències aïllades a partir dels 10 clons de la mostra SA 5/03 p.180
Figura 2.6. Alineament de les seqüències d’aminoàcids de tots els aïllats obtinguts per clonació, així com les de BCN8 i BCN9, obtingudes per seqüenciació directa de l’amplificat de SA4/01

Figura 2.6.

Alineament de les seqüències d’aminoàcids de tots els aïllats obtinguts per clonació, així com les de BCN8 i BCN9, obtingudes per seqüenciació directa de l’amplificat de SA4/01 p.181
Figura 1.1. Organització del genoma del VHE en tres ORF o pautes obertes de lectura. Els dominis identificats a l’ORF1 són: un domini metiltransferasa (Met), un domini Y (Y), un domini de proteasa papain-like (Prot), una regió hipervariable rica en proline

Figura 1.1.

Organització del genoma del VHE en tres ORF o pautes obertes de lectura. Els dominis identificats a l’ORF1 són: un domini metiltransferasa (Met), un domini Y (Y), un domini de proteasa papain-like (Prot), una regió hipervariable rica en proline p.190
Figura 1.2. Fotografia obtinguda per microscopia electrònica mostrant

Figura 1.2.

Fotografia obtinguda per microscopia electrònica mostrant p.191
Figura 1.3. Model de replicació proposat per Reyes i col., 1993. Esquema extret

Figura 1.3.

Model de replicació proposat per Reyes i col., 1993. Esquema extret p.196
Figura 1.4. Distribució del VHE    . Les àrees ratllades corresponen a regions amb epidèmies documentades d’infeccions pel VHE i/o a on >25% de les hepatitis no-A-B són atribuïbles al VHE

Figura 1.4.

Distribució del VHE . Les àrees ratllades corresponen a regions amb epidèmies documentades d’infeccions pel VHE i/o a on >25% de les hepatitis no-A-B són atribuïbles al VHE p.200
Figura 1.5. Curs de l’hepatitis E en primats no humans (extret de Purcell i Emerson, 2001 i basat en dades de McCaustland i col., 2000 i Tsarev i col., 1995)

Figura 1.5.

Curs de l’hepatitis E en primats no humans (extret de Purcell i Emerson, 2001 i basat en dades de McCaustland i col., 2000 i Tsarev i col., 1995) p.217

Referencias

Actualización...

Related subjects : Hepatitis E