• No se han encontrado resultados

Anticuerpos tipo IgG e IgY específicos contra GALNS pueden ser usados en un ensayo de inmuno-cuantificación para la detección de la enzima

N/A
N/A
Protected

Academic year: 2022

Share "Anticuerpos tipo IgG e IgY específicos contra GALNS pueden ser usados en un ensayo de inmuno-cuantificación para la detección de la enzima"

Copied!
58
0
0

Texto completo

(1)

PURIFICACIÓN DE ANTICUERPOS POLICLONALES EN GALLINA (IgY) Y CONEJO (IgG) PRODUCIDOS CONTRA SECUENCIAS PEPTÍDICAS DE LA ENZIMA

N-ACETILGALACTOSAMINA-6-SULFATO SULFATASA (GALNS) Y SU APLICACIÓN EN LA IMPLEMENTACIÓN DE UNA TÉCNICA ELISA TIPO

“SANDWICH”

LINA MARÍA LIZARASO TRESPALACIOS

TRABAJO DE GRADO Presentado como requisito parcial

Para optar al título de

BIÓLOGA

LUIS ALEJANDRO BARRERA AVELLANEDA- Ph.D DIRECTOR

PONTIFICIA UNIVERSIDAD JAVERIANA FACULTAD DE CIENCIAS

CARRERA DE BIOLOGÍA BOGOTÁ D.C.

JUNIO 23 DEL 2009

(2)

NOTA DE ADVERTENCIA

Artículo 23 de la Resolución N° 13 de Julio de 1946

“La Universidad no se hace responsable por los conceptos emitidos por sus alumnos en sus trabajos de tesis. Sólo velará porque no se publique nada contrario al dogma y a la moral católica y por que las tesis no contengan ataques personales contra persona alguna, antes bien se vea en ellas el anhelo de buscar la verdad y la justicia”

(3)

PURIFICACIÓN DE ANTICUERPOS POLICLONALES EN GALLINA (IgY) Y CONEJO (IgG) PRODUCIDOS CONTRA SECUENCIAS PEPTÍDICAS DE LA ENZIMA

N-ACETILGALACTOSAMINA-6-SULFATO SULFATASA (GALNS) Y SU APLICACIÓN EN LA IMPLEMENTACIÓN DE UNA TÉCNICA ELISA TIPO

“SANDWICH”

LINA MARÍA LIZARASO TRESPALACIOS

APROBADO

Luis A. Barrera Avellaneda, PhD. Alfonso Barreto, M.Sc.

DIRECTOR PAR ACEDÉMICO

(4)

RESUMEN

N-acetilgalactosamina-6-sulfato sulfatasa (GALNS; EC3.1.6.4) es una enzima lisosomal perteneciente a la familia de las sulfatasas humanas. Su deficiencia causa un trastorno conocido como Mucopolisacaridosis tipo IVA (MPS IVA; síndrome de Morquio A). Anticuerpos tipo IgG e IgY específicos contra GALNS pueden ser usados en un ensayo de inmuno-cuantificación para la detección de la enzima. En este trabajo, se produjeron anticuerpos policlonales en conejo (IgG anti-GALNS), utilizando secuencias no conservadas presentes en GALNS y ausentes en otras sulfatasas humanas. Los anticuerpos tipo IgY se purificaron mediante una extracción orgánica y columna tiofílica; posteriormente fueron biotinilados. Las IgGs se purificaron mediante una columna de afinidad (Hi Trap-Protein A). Los procesos de purificación de los anticuerpos (IgG e IgY) fueron evaluados por SDS-PAGE, Western Blot y ELISA indirecta. La electroforesis bajo condiciones no reductoras mostró una única banda correspondiente a los eluídos de los anticuerpos IgY e IgG (180 kDa y 150 kDa, respectivamente). Los anticuerpos producidos contra la enzima GALNS fueron reconocidos mediante la técnica de ELISA indirecta y no se observó reactividad cruzada con la Iduronato-2-sulfato sulfatasa (IDS EC 3.1.6.13), enzima que se utilizó como control. Los anticuerpos producidos contra secuencias peptídicas de GALNS (20 aminoácidos / péptido), fueron capaces de detectar la enzima completa mediante la técnica de Western Blot. La biotinilación de los anticuerpos afectó el reconocimiento de la enzima. La ELISA tipo “sandwich” está en proceso de implementación, con la combinación de los dos anticuerpos, IgG como anticuerpo de captura e IgY como anticuerpo de reconocimiento, para la determinación de la concentración de la enzima. Esta técnica no sólo depende del reconocimiento de los anticuerpos frente a la molécula de interés, sino de la especificidad y pureza de los anticuerpos, así como de las mejores condiciones que minimicen las reacciones no-específicas y que incrementen la afinidad de la interacción antígeno-anticuerpo.

(5)

ABSTRACT

N-acetylgalactosamine-6-sulfatase (GALNS; E.C.3.1.6.4) is a lysosomal enzyme belonging to the human sulphatases family. Its deficiency causes a disorder known as Mucopolysaccharisosis type IVA (MPS IVA; Morquio A syndrome). ELISA assay with IgY and IgG antibodies can be used in an immunoquantification assay for the detection of GALNS. Rabbit IgG anti-GALNS polyclonal antibodies were produced, using non-conserved peptides present in GALNS and absent in other human sulphatases. IgY antibodies were purified by an organic extraction and through thiophilic column and were biotinylated. IgG antibodies were purified using a Hi-Trap Protein A affinity column. Purification process of the antibodies (IgY and IgG) were evaluated by SDS-PAGE, Western Blot and indirect ELISA. Electrophoresis under non reducing conditions showed a unique band corresponding to the eluted antibodies IgY and IgG (180 kDa and 150 kDa respectively). Antibodies against GALNS were recognized by indirect ELISA and no cross- reactivity was observed with Iduronate-2-sulphatase (IDS EC 3.1.6.13) enzyme used as a control.

Antibodies were produced against GALNS peptides (20 amino acids / peptide) and were able to detect the whole enzyme by Western Blot technique. Biotinylation process affected antigen recognition. Indirect ELISA assay with IgY and IgG antibodies can be used in an immunoquantification assay for the detection of the enzyme. A sandwich ELISA assay is being used with the combination of the two antibodies, IgG as capture antibody and IgY as detection antibody, for the determination of the enzyme concentration. Implementation of an ELISA

“sandwich” technique depends not only in the recognition of the antibodies to the molecule of interest, but in the specificity, the purity of the antibodies and the optimum conditions to minimize non-specific reactions and to improve the affinity of antigen-antibody interactions.

(6)

vi AGRADECIMIENTOS

Gracias a Dios por estar siempre presente en cada uno de los momentos más importantes de mi vida, por ser la guía en cada uno de mis actos y la fuerza que me empuja a lograr mis metas. A mi mami por ser mi apoyo, mi guía, mi consejera, mi amiga, por haber sufrido esta tesis incluso más que yo y ayudarme a creer siempre en mí, por ser lo más importante en mi vida!!!.

A mis abuelitos (los adoro), tíos, primos: a Clari por ser como mi segunda mamá, a Andre por ser como mi hermanita y por estar siempre ahí cuando te necesitaba, a la chiqui por sacarme una sonrisa en todo momento, a Li por preocuparte siempre por mí, a mi tía Narda gracias por todo, sobran las palabras, a Mary por ayudarme siempre y apoyarme en todo, te quiero mucho.

A mi hermanito Juanma, por ser un maravilloso regalo que la vida me dio, los días en la universidad son más agradables gracias a ti, te chelo mucho. A Rochi, por ayudarme siempre en todo, en mi tesis, en la U, por ser una excelente amiga. Alejita muchas gracias por ser una gran amiga, por escucharme, animarme, por darme fuerza, simplemente por ser esa gran personita que eres.

A Sebas porque aunque no lo creas, me diste una gran motivación para luchar por obtener buenos resultados, nuestras charlas acerca de la ciencia han sido una gran enseñanza. Me hiciste mucha falta este semestre, pero me alegra mucho que en estos días me estés acompañando. Le doy gracias a la vida por poder crecer como persona a tu lado.

Al doctor Barrera por el apoyo, la confianza, por todas las enseñanzas. Gracias doc por permitirme entrar a uno de los mejores grupos de investigación, a la mejor escuela que tuve en la universidad, por ayudarme a crecer personal y profesionalmente.

A la familia IEIM, los días de trabajo se hacen más amenos gracias a ustedes. A Rodríguez, gracias por ser mi maestro, por hacer de mí una mejor persona, por tener siempre las palabras perfectas en el momento preciso, te quiero mucho. A Cata por ser mi guía en el laboratorio, GRACIAS por todas las enseñanzas, por todo el apoyo, la paciencia y la ayuda, por darme ánimo

(7)

vii

y confianza en mi trabajo, lo logramos!!!. A Joko, por ser como mi hermanita en el lab, por no dejarme sola en ningún momento, por escucharme y ayudarme siempre en todo lo que necesitaba.

A Andre por estar pendiente de mí aunque no estabas cerca, por darme fuerza, por escucharme, por aconsejarme, te quiero mucho. A Javi y Olguita por siempre tener la explicación perfecta a todo, gracias por toda su ayuda. A Juanis por hacer que los días de trabajo en el lab estuvieran llenos de alegría, por estar pendiente de todos mis experimentos y darme ánimo en todo momento. A Alejo por nuestras charlas, por acompañarme hasta tarde los días de ELISA. A Jenny por hacer que todos los trámites administrativos se hicieran más pronto. A Ana Rosita, Alejo, Magdita, Nina, Inés Estela por estar siempre dispuestos a ayudarme.

A Fer, por haberme recibido en la Universidad de los Andes, por ser un gran maestro, por estar siempre dispuesto a ayudarme. Una de las mejores decisiones que pude haber tomado en la universidad fue el haber ido a tu laboratorio. Gracias por ser un ejemplo a seguir, por todos los conocimientos compartidos, por esa calidad humana difícil de encontrar.

Al semillero de Neurociencias y comportamiento porque se han convertido en personitas muy importantes para mí, por todas las enseñanzas de neuro, por estar dispuestos a ayudarme en lo que necesitaba y apoyarme en todas mis decisiones. A Lali por ser un apoyo enorme durante todo este semestre, por estar siempre dispuesta a ayudarme, animarme y escucharme. A Andresito por todo el apoyo y las ideas para mi tesis. A moni por darme ánimo en todo momento, lo logramos moni ya somos dos biólogas!!!, a la Monita por siempre recibirme con los brazos abiertos, por escucharme, por estar pendiente de mí. A Rodri, Marlysilla, Lauris por tener siempre las palabras de apoyo que necesitaba, por sacarme siempre una sonrisa, por darme fuerza y recordarme que iba a sacar mi tesis adelante. A Misael, Andresito Vega, Cesar, Enrique, Lau, por compartir todos sus conocimientos conmigo.

Al doctor Tomatsu por la donación de la enzima N-acetil galactosamina-6-sulfato sulfatas recombinante humana (GALNS).

(8)

viii TABLA DE CONTENIDOS

1. INTRODUCCIÓN 1

2. REVISIÓN DE LITERATURA 3

2.1. Mucopolisacaridosis (MPS) 3

2.1.1. Enfermedad de Morquio A ó MPS tipo IVA 4

2.2. GALNS 6

2.3. Sistema de detección de antígenos solubles: ELISA 7

2.3.1. ELISA tipo “sandwich” 7

2.4. Producción de anticuerpos policlonales 10

2.4.1. Producción de anticuerpos policlonales en gallina 11 2.4.2. Producción de anticuerpos policlonales en conejo 16

2.5. Purificación de anticuerpos 16

3. MATERIALES Y MÉTODOS 20

3.1. Purificación de anticuerpos IgY 20

3.1.1. Marcaje de anticuerpos purificados IgY anti-GALNS con biotina 20 3.2. Determinación de proteínas totales por el método de Folin-Lowry 20

3.3. Electroforesis en gel de poliacrilamida 21

3.4. Detección de GALNS mediante ELISA indirecta 21

3.5. Western Blot 22

3.6. Producción y Purificación de IgG α-GALNS 22

3.7. ELISA tipo “sandwich” 23

4. RESULTADOS 25

4.1. Purificación de anticuerpos 25

4.2. Concentración de proteínas totales por el método de Folin-Lowry 26 4.3. Evaluación del proceso de purificación por electroforesis en gel de

poliacrilamida

27

(9)

ix

4.4. Reconocimiento de los anticuerpos purificados de gallina por ELISA indirecta

29

4.5. Reconocimiento de los anticuerpos purificados de conejo por ELISA indirecta

30 4.6. Reconocimiento del anticuerpo biotinilado de gallina por ELISA

indirecta

31

4.7. Detección de GALNS mediante la técnica de Western Blot 32 4.7.1. Comparación de la secuencia de GALNS con los péptidos utilizados en

la inmunización de gallinas y conejos

34

4.8. ELISA tipo “sandwich” 35

4.8.1. Evaluación de las mejores condiciones para la ELISA tipo “sandwich” 36

5. DISCUSIÓN DE RESULTADOS 40

6. CONCLUSIONES 44

7. RECOMENDACIONES 44

8. REFERENCIAS 45

(10)

1 1. INTRODUCCIÓN

Las Enfermedades de Depósito Lisosomal (LSD- en inglés Lysosomal Storage Diseases) son Errores Innatos del Metabolismo (EIM) en su mayoría heredadas de manera autosómica recesiva.

Las LSD se caracterizan generalmente por la deficiencia o ausencia de una enzima lisosomal particular causando la acumulación de sustratos normalmente degradados dentro del lisosoma (Meikle and Hopwood 2003; Ashok 2005). Dentro de este tipo de desórdenes se encuentra la enfermedad de Morquio A o Mucopolisacaridosis (MPS) tipo IVA (Neufeld and Muenzer 2001).

El síndrome de Morquio A, es un desorden autosómico recesivo causado por la deficiencia o ausencia de la enzima N – acetilgalactosamina -6- sulfato – sulfatasa (GALNS; E.C.3.1.6.4), la cual cataliza la remoción del grupo sulfato de la N-acetil galactosamina -6- sulfato en el proceso de degradación del condroitin -6-sulfato y de la galactosa -6-sulfato en el queratán sulfato (Neufeld and Muenzer 2001; Tomatsu et al. 2004a; Montaño et al. 2007b). Clínicamente esta enfermedad se caracteriza por la presencia de deformidades esqueléticas y diversas complicaciones, entre las que se encuentran compromiso pulmonar, daño en las válvulas cardiacas, pérdida de audición, hepatomegalia y compresión medular entre otros (Neufeld and Muenzer 2001; Montaño et al. 2007b). Al igual que en otros errores del metabolismo el defecto se halla a nivel del gen que codifica para la enzima, lo que hace que esta sea una patología intratable mediante terapéutica convencional (Barrera et al. 2004). Actualmente se encuentra en desarrollo la Terapia de Reemplazo Enzimático (TRE) como tratamiento para la enfermedad de Morquio A (Tomatsu et al. 2003).

Para el diagnóstico de las MPSs se utilizan pruebas para determinar la actividad enzimática (van Diggelen et al. 1990), sin embargo para otras LSD (MPS I, MPS VI y enfermedad de Fabry) se han desarrollado inmunoensayos para la detección de proteínas involucradas en la enfermedad, utilizando este tipo de métodos como alternativa para asistir en el diagnóstico (Ashton et al.

1992; Hein et al. 2005; Parkinson-Lawrence et al. 2007). Parkinson-Lawrence y colaboradores (2006) realizaron un inmunoensayo para la detección de la enfermedad de Morquio A utilizando muestras de fibroblastos. En su trabajo encontraron que las muestras de los pacientes con Morquio A tenían niveles muy bajos de proteína, lo cual es consistente con la alteración estructural significativa de la enzima GALNS en pacientes con la enfermedad, sugiriendo que la

(11)

2

ausencia de proteína GALNS podría ser usada en el desarrollo de un método de diagnóstico de la enfermedad.

En el Instituto de Errores Innatos del Metabolismo (IEIM) se ha trabajado en el desarrollo de un sistema de detección ELISA tipo “sandwich” basado en la cuantificación de la Iduronato -2- sulfato - sulfatasa (IDS) enzima deficiente en la enfermedad de Hunter o MPS II utilizando anticuerpos policlonales epítope específicos producidos en gallina. Los resultados de este estudio muestran que la técnica es capaz de detectar la presencia de la enzima en plasma humano, lo cual podría ser útil como prueba de ayuda del método fluorométrico en los casos en que la enzima haya sufrido daños en su actividad enzimática por cambios en la temperatura y descongelación de muestras (Sosa et al. 2009-Datos sin publicar). En este trabajo se propuso la purificación de anticuerpos epítope específicos IgY e IgG anti-GALNS y su aplicación en la implementación de una técnica ELISA tipo “sandwich” para la detección de la enzima GALNS, que puede ser útil para dar seguimiento a los procesos de expresión y purificación de proteínas recombinantes.

Adicionalmente podría permitir el establecimiento de una correlación entre la actividad enzimática y la cantidad de proteína o enzima específica del paciente lo cual puede ser útil para el diagnóstico y tratamiento (Meikle et al. 1997; Meikle and Hopwood 2003).

(12)

3 2. REVISIÓN DE LITERATURA

2.1. Mucopolisacaridosis (MPS)

Las LSD son Errores Innatos del Metabolismo (EIM) y comprenden más de 40 enfermedades genéticas, en su mayoría heredadas de manera autosómica recesiva. Las MPSs son enfermedades de depósito lisosomal que se caracterizan por la deficiencia o ausencia de una proteína requerida para el proceso de degradación de los mucopolisacáridos o Glucosaminoglicanos (GAGs):

Dermatán Sulfato (DS), Heparán Sulfato (HS), Condroitin Sulfato (CS), Queratán Sulfato (KS) y Ácido Hialurónico (Neufeld and Muenzer 2001; Tomatsu et al. 2003). Los GAGs son un componente importante de la matriz extracelular del tejido conectivo y se encuentran en grandes cantidades en el cartílago, córnea, hueso, válvulas cardíacas, piel, tendones y en pequeñas cantidades en órganos viscerales, músculos, vasos sanguíneos y en el cerebro; la alteración en su degradación principalmente es la causa de mutaciones en los genes que codifican para hidrolasas lisosomales (Tabla 1) o por la deficiencia de una proteína activadora de la enzima o de transportadores de la membrana lisosomal (Menéndez et al. 2002; Tomatsu et al. 2004b; Clarke 2008).

Tabla 1. Clasificación de las Mucopolisacaridosis (MPS). Tomado de Neufeld and Muenzer, 2001.

MPS Nombre de la

enfermedad

Enzima deficiente GAG’s acumulados Manifestaciones clínicas

Tipo I Hurler α-L-Iduronidasa Dermatán y

Heparán

Opacidad Corneal, Disostosis Multiple,

Organomegalia, Enfermedad Cardiaca,

Muerte en la infancia

Tipo I Scheie α-L-Iduronidasa Dermatán y

Heparán

Opacidad Corneal, Rigidez articular, Inteligencia

Normal.

Tipo I/S Hurler/Scheie α-L-Iduronidasa Dermatán y Heparán

Fenotipo Intermedio entre IH y IS

Tipo II Hunter Leve Iduronato-2-sulfato (IDS) Dermatán y Heparán

Inteligencia Normal, Corta estatura, Supervivencia 20-

60 años Tipo II Hunter Severa Iduronato-2-sulfato (IDS) Dermatán y

Heparán

Disostosis Multiple, Organomegalia. Muerte

antes de los 15 años.

(13)

4 Tipo IIIA San Filipo A Heparán-N-Sulfatasa

(Sulfaminidasa)

Heparán Sulfato Deterioro mental profundo.

Hiperactividad.

Manifestaciones somáticas medias

Tipo IIIB San Filipo B α-N-Acetil

Glucosaminidasa

Heparán Sulfato Fenotipo similar a IIIA

Tipo IIIC San Filipo C Acetil CoA: α- glucosamina acetiltranferasa

Heparán Sulfato Fenotipo similar a IIIA

Tipo IIID San Filipo D N-acetil glucosamina -6- sulfato sulfatasa

Heparán Sulfato Fenotipo similar a IIIA

Tipo IVA Morquio A N-acetilgalactosamina -6- sulfatasa (GALNS)

Queratán y Condroitin Sulfato

Deformidades Esqueléticas. Hipoplasia

odontoide, Opacidad Corneal Tipo IVB Morquio B β-Galactosidasa Queratán Sulfato Espectro similar a IVA Tipo VI Maroteaux Lamy Arilsulfatasa B Dermatán Sulfato Disostosis Múltiple,

Opacidad Corneal, Inteligencia Normal

Tipo VII Sly β-Glucuronidasa Dermatán, Heparán

y Condroitin Sulfato.

Disostosis Múltiple, Hepatoesplenomegalia,

Amplio espectro de severidad

2.1.1. Enfermedad de Morquio A ó MPS tipo IVA

El síndrome de Morquio, descrito en 1929 por el pediatra uruguayo Luis Morquio, es un desorden autosómico recesivo causado por la deficiencia de la enzima N – acetilgalactosamina – 6 sulfato sulfatasa (GALNS; E.C.3.1.6.4), la cual cataliza la remoción del grupo sulfato de la N- acetil galactosamina 6 sulfato en el proceso de degradación del condroitin 6-sulfato y de la galactosa 6-sulfato en el queratán sulfato (Neufeld and Muenzer 2001; Tomatsu et al. 2004a;

Montaño et al. 2007b).

La incidencia de la MPS tipo IVA no es conocida con certeza, se encuentra aproximadamente entre 1:40000 y 1:200000 nacidos vivos variando de acuerdo a cada región (Barrera et al. 2004;

Tomatsu et al. 2005). La MPS IVA en Colombia podría ser considerada como la mucopolisacaridosis de mayor incidencia. Al igual que en otras MPSs, los pacientes Morquio A al nacer son normales, la sintomatología clínica aparece entre el primer y los 3 años de edad con un promedio a los 2.1 años, aunque el diagnóstico generalmente se realiza en promedio a los 4.7

(14)

5

años de edad y se confirma a una edad media entre los 3 y 5 años (Neufeld and Muenzer 2001;

Montaño et al. 2007b).

A diferencia de la mayoría de las MPSs, las habilidades intelectuales son potencialmente normales (Montaño et al. 2007b). La severidad de este síndrome está determinada por el tipo de mutación y se caracteriza principalmente por la presencia de deformidades esqueléticas, debido a la acumulación excesiva de KS y CS, también se presenta estatura corta con una altura promedio de 100 cm en adultos, displasia espondiloepifiseal, coxa valga, escoliosis, genu valgum, hipoplasia odontoide, opacidad corneal, alteraciones al caminar, restricción en el movimiento de las paredes del pecho y una vida media entre 20 a 30 años en el caso del fenotipo clínico severo (Neufeld and Muenzer 2001; Tomatsu et al. 2003; Tomatsu et al. 2004a; Montaño et al. 2007b) y otro tipo de complicaciones entre los que se encuentran compromiso pulmonar, daño en las válvulas cardiacas, pérdida de audición, hepatomegalia, dientes anchos espaciados con esmalte delgado y frecuentes caries y compresión medular entre otros (Neufeld and Muenzer 2001;

Montaño et al. 2007b). En el caso del fenotipo clínico leve se ha reportado en los pacientes con MPS tipo IVA una vida media de 70 años de edad con una calidad de vida normal y un compromiso leve en los huesos y órganos viscerales (Neufeld and Muenzer 2001; Tomatsu et al.

2004a).

En la actualidad no existen en el mercado tratamientos para la prevención o cura de la enfermedad de Morquio A. Hasta el momento, se utilizan medidas de soporte para tratar las manifestaciones clínicas como fármacos anti-inflamatorios no esteroides para el dolor, antibióticos para las infecciones y suplemento de oxígeno para el compromiso pulmonar (Neufeld and Muenzer 2001). También pueden ser requeridas intervenciones quirúrgicas para los problemas esqueléticos (Neufeld and Muenzer 2001; Barrera et al. 2004). Actualmente se encuentra en desarrollo la TRE como tratamiento para la enfermedad de Morquio A. Tomatsu y colaboradores (2003) han elaborado tres modelos Knock- out en ratón de la MPS tipo IVA para estudiar la patogénesis de la enfermedad y evaluar la efectividad de diferentes protocolos en el adelanto de terapias para la enfermedad (Neufeld and Muenzer 2001; Tomatsu et al. 2003).

(15)

6 2.2. GALNS

GALNS es una enzima lisosomal que se encuentra dentro de la familia de las sulfatasas (Tomatsu et al. 2004b). La enzima ha sido purificada en el hígado como un oligómero de 39 y 19 kDa y en la placenta humana como un oligómero de 120 kDa que consiste en polipéptidos de 40 y 15 kDa unidos por puentes disulfuro (Sukegawa et al. 2000). Tomatsu y colaboradores (2007) realizaron una caracterización de la enzima recombinante humana GALNS y de la enzima recombinante humana GALNS (rhGALNS) purificada y coexpreseda con el factor SUMF1 (57, 39, 19 kDa), encontrando un aumento en la actividad enzimática en la rhGALNS coexpresada con SUMF1 (Tomatsu et al. 2007). El gen que codifica para la enzima GALNS está localizado en el cromosoma 16q24 y codifica para una proteína de 552 aminoácidos, incluyendo un péptido señal de 26 residuos. Hasta el momento, cerca de 150 mutaciones han sido identificadas, la mayoría corresponden a pequeñas deleciones y mutaciones puntuales sin sentido (Sukegawa et al. 2000;

Tomatsu et al. 2003). En el lisosoma, esta enzima es un componente del complejo funcional de 1.27MDa que incluye la β-galactosidasa (EC 3.2.1.23), α-neuraminidasa (EC 3.2.1.18) y la catepsina A carboxypeptidasa serina (EC 3.4.16.1) (Sukegawa et al. 2000). El modelo estructural de la enzima (Figura 1) posee una forma monomérica con dos dominios: el dominio mayor, N- terminal y el dominio menor, C-terminal (Sukegawa et al. 2000).

Figura 1. Modelo terciario estructural de la proteína GALNS. En la parte superior se encuentra el dominio N- terminal y en la parte inferior el domino C- terminal. Tomada de Sukegawa, et al. 2000.

(16)

7

Todas las sulfatasas en el sitio activo (sitio catalítico) poseen una modificación post- traduccional, en donde residuos de formilglicina son generados a partir de una cisteína; el sitio activo se determina por la presencia de residuos conservados rodeando los residuos de cisteína (Sukegawa et al. 2000). Las mutaciones que ocurren en el sitio activo están relacionadas con el fenotipo severo de la enfermedad resultando en una actividad nula de la enzima. En el fenotipo moderado se han encontrado mutaciones “atenuadas” con un amplio rango de actividad residual de la enzima, sugiriendo que estas mutaciones se encuentran fuera del sitio activo, sin afectar de manera crucial a la actividad enzimática (Fukuda et al. 1992; Richards 2002; Montaño et al.

2007a).

2.3. Sistema de detección de antígenos solubles: ELISA

Los métodos inmunológicos o inmunoensayos se han utilizado ampliamente para la detección y cuantificación de antígenos. La técnica ELISA (en inglés Enzyme Linked Immunosorbent Assay) se utiliza como método de cuantificación y detección de proteínas, anticuerpos específicos, antígenos solubles o antígenos celulares de superficie (Twyman 2005). Esta técnica presenta numerosas variaciones dentro de las que se encuentran la ELISA competitiva, la ELISA indirecta y la ELISA tipo “sandwich” entre otros (Pierce 2002; Twyman 2005). La técnica de ELISA indirecta se utiliza principalmente para la detección de anticuerpos en muestras no conocidas.

2.3.1. ELISA tipo “sandwich”

La ELISA tipo ”sándwich” es una de las técnicas más sensibles y específicas para la cuantificación de moléculas; esta técnica requiere dos anticuerpos, el de captura y el de reconocimiento, para la detección de diferentes epítopes en el antígeno (Fukuda et al. 1992). Esta técnica no requiere de la purificación previa del antígeno para su cuantificación, por lo que es usada para la detección de antígenos solubles en muestras no conocidas (Twyman 2005).

Para la reproducibilidad y especificidad de la técnica se deben tener en cuenta algunos parámetros como el pH de la solución de fijación, la concentración del anticuerpo de captura y reconocimiento, la concentración del antígeno, el tipo de sustrato, el tipo de fase sólida y de

(17)

8

solución de bloqueo, los lavados, el tiempo y la temperatura óptima de incubación, la enzima de conjugación, la estabilidad de la enzima y del sustrato (Koivunen and Krogsrud 2006).

Modificaciones en la técnica como el marcaje de anticuerpos, podría incrementar la sensibilidad de la técnica (Voller et al. 1978).

Los antígenos y anticuerpos se unen fácilmente a la fase sólida por adsorción pasiva, probablemente como resultado de las interacciones hidrofóbicas entre la proteína y el plástico de la placa. Entre los factores que se deben tener en cuenta está la difusión de la molécula adherida, el área a fijar Vs. el volumen de solución de fijación, la adecuada concentración de los antígenos o anticuerpos adsorbidos, la temperatura y el tiempo de adsorción. Cuando hay exceso en la concentración del antígeno se da una unión incorrecta con el anticuerpo, debido a un incremento en la agregación del antígeno (las moléculas estarían muy juntas) ó a la formación de capas de antígeno, resultando en una menor estabilidad de la interacción. Otro factor que se debe considerar es la orientación y concentración del anticuerpo con el fin de lograr estabilidad en las interacciones antígeno-anticuerpo (Crowther 1995).

El tiempo de fijación y la temperatura varía de acuerdo a cada proteína, cualquier factor puede afectar la fijación. El rango de interacciones hidrofóbicas depende de la temperatura, a mayor temperatura mayor rango de interacciones, sin embargo un aumento en la temperatura causa en el antígeno un efecto deletéreo en la fijación. Las temperaturas de incubación que usualmente se usan son 37°C, 4°C o una combinación de ambas. Una manera de asegurar un incremento en el rango de contacto es rotar la placa (Crowther 1995). Esta rotación permite la mezcla de todos los reactivos utilizados requiriendo de un menor tiempo para que se den las interacciones antígeno anticuerpo, además el rotar la placa es independiente de consideraciones de temperatura. En el caso de no rotar la placa, la mezcla de los reactivos se fundamenta en la difusión de las moléculas por lo que se requieren mayores tiempos de incubación (Crowther 1995).

Los buffers de fijación normalmente usados son carbonato 50mM pH 9.6, tris HCl 20mM, PBS pH 7.2 ó 7.4. En teoría se debe utilizar un buffer con un valor de pH 1 o 2 unidades por encima del valor del PI (punto isoeléctrico) de la proteína que se va a fijar (Crowther 1995).

(18)

9

Durante los pasos de la ELISA se realizan lavados con el fin de separar reactivos libres unidos y no unidos. Se recomienda utilizar durante los lavados PBS (0.1M pH=7.4) para mantener la isotonicidad debido a que la mayoría de las reacciones antígeno-anticuerpo se dan bajo esas condiciones. En algunos casos se añaden detergentes como Tween 20 a la solución de lavado, sin embargo en la mayoría de los casos esta adición no contribuye significativamente al proceso de lavado, pero si puede causar la denaturación del antígeno por lo que debe tenerse cuidado al utilizar este tipo de detergentes (Crowther 1995).

Con el fin de evitar adsorciones no específicas de proteínas a los pozos en los espacios vacíos en la fase sólida se utilizan las soluciones de bloqueo (sustancias inertes inmunológicamente), que tienen como objetivo eliminar las uniones inespecíficas por medio de la competencia con los factores inespecíficos de la muestra por los sitios disponibles en la placa, estas sustancias no deben reaccionar con el antígeno o el conjugado empleado (Crowther 1995).

Otro punto importante es la selección de la enzima conjugada para la obtención del producto coloreado con un sustrato específico (Chernesky and Mahony 1996). Uno de los más utilizados es Horseradish Peroxidase (HRP), una enzima comercial de bajo peso molecular y estable, que se encuentra en pequeñas cantidades en la raíz de de la planta de rábano picante (Horseradish).

Además, posee otras propiedades como la disponibilidad de un amplio rango de actividad en los sistemas de detección y la capacidad de oxidación en productos altamente detectables (Chernesky and Mahony 1996; Abuknesha et al. 2005).

Para aumentar la sensibilidad de la técnica se han utilizado anticuerpos de reconocimiento biotinilados para la amplificación y aumento de la señal de unión. La biotina o vitamina H, es una molécula pequeña (244.31 Da), que se une con alta afinidad a proteínas como la avidina y la estreptavidina, presenta un grupo carboxilo que permite su unión a grupos amino de las proteínas.

El sistema Biotina-Estreptavidina se utiliza en pruebas inmunológicas debido a que posee características únicas de interacción como: 1. no afectar la actividad biológica cuando se une a moléculas biológicamente activas de catálisis enzimática o de unión a los anticuerpos, 2. asegurar la unión a la molécula blanco de interés, 3. estabilidad a cambios de pH, múltiples lavados, temperatura y moléculas químicas, debido a la alta afinidad del complejo (Diamandis and

(19)

10

Christopoulos 1991). En el caso de las proteínas, su biotinilación se realiza utilizando análogos de la biotina como el éster N-hidroxisuccinimida (NHS-éster). Para este proceso se utiliza el reactivo conocido como NHS-LC Biotin, el cual tiene un brazo espaciador de cadena larga que permite una detección sensible del sistema reduciendo el impedimento estérico. Este reactivo usualmente se utiliza por su brazo espaciador y por su reactividad hacia aminas primarias encontradas en la mayoría de péptidos y en muchas proteínas (Diamandis and Christopoulos 1991). La estreptavidina es una proteína grande no glicosilada homotetramérica, con un peso molecular aproximado de 60.000 Da. Se obtiene de la bacteria Streptomyces avidiini y posee un punto isoeléctrico bajo (6.1) lo que resulta en una unión no-específica baja.

Trabajos previos han evaluado el efecto de la biotinilación en la especificidad de los anticuerpos monoclonales encontrando una disminución de la especificidad y afinidad de los anticuerpos (Hoyer-Hansen et al. 2000). Muzykantov y colaboradores (2002) reportan que un exceso de biotina durante el proceso causa una disminución en la afinidad del anticuerpo al inducir alteraciones complejas de las propiedades funcionales del anticuerpo.

2.4. Producción de anticuerpos Policlonales

En los inmunoensayos un factor de gran importancia son los anticuerpos, en donde su producción debe ser específica, reproducible, estandarizada y además dichos anticuerpos deben tener una interacción de alta afinidad con los analitos del ensayo. Igualmente, deben poseer gran estabilidad durante su almacenamiento y se deben poder producir en cantidades y concentraciones elevadas (Campbell et al. 1996).

Los anticuerpos policlonales son anticuerpos secretados en respuesta a una inmunización con un antígeno en el que se estimulan las células B para el reconocimiento de diferentes epítopes del inmunógeno. Para la producción de anticuerpos policlonales se requiere de inmunizaciones repetidas a un animal con el antígeno deseado, obteniendo grandes cantidades de anticuerpos heterogéneos con un amplio rango de uniones de afinidad. Una vez se obtienen los anticuerpos estos deben ser purificados. Esta producción no es costosa, ni requiere de tanta destreza y tiempo como en la producción de anticuerpos monoclonales (Stapleton et al. 2005).

(20)

11

El propósito de utilizar adyuvante es maximizar la respuesta inmune de los anticuerpos frente a un antígeno soluble al exponerlo por más tiempo en el organismo. Debido a que las proteínas cuando se administran solas son poco o no inmunogénicas es conveniente su administración con adyuvantes (estimuladores no específicos de la respuesta inmune) (Campbell et al. 1996;

Stapleton et al. 2005).

Uno de los adyuvantes más utilizados es el de Freund completo e incompleto. El completo se usa únicamente en la primera inmunización, contiene una suspensión de bacterias muertas por calor (Mycobacterium tuberculosis) en aceite mineral y un emulsificador, el propósito de la micobacteria en el adyuvante es causar inflamación para la atracción de macrófagos y otras células en el sitio de inyección favoreciendo la activación linfocitaria, el adyuvante incompleto se usa en las siguientes inmunizaciones, no contiene bacterias en suspensión, pero contiene emulsificante, que permite prolongar la exposición del antígeno en el sistema inmune formando un depósito protector de un catabolismo rápido (Campbell et al. 1996; Stapleton et al. 2005).

2.4.1. Producción de anticuerpos policlonales en gallina

La producción de anticuerpos en huevo de gallina, surge como una alternativa que pretende disminuir inconvenientes en el manejo de los animales, ya que no se requiere del sangrado ni del sacrificio de los mismos (Chacana et al. 2004).

En 1969 Leslie y Clem encontraron numerosas diferencias estructurales de las inmunoglobulinas presentes en el suero de las aves con las IgG (Figura 2), proponiendo el nombre de IgY (γ-livetin) para estas inmunoglobulinas (Leslie and Clem 1969; Narat 2003; Yoshimura 2004). La IgY es un anticuerpo compuesto al igual que la IgG de dos cadenas pesadas entre 67-70 kDa y dos cadenas livianas de 25 kDa. La IgG en mamíferos contiene 3 regiones constantes (Cγ1- Cγ3), mientras que la IgY tiene 4 (Cν1- Cν4); lo cual hace la diferencia entre sus pesos moleculares (PM), 180kDa para la IgY y 150kDa para la IgG. Otra diferencia entre estos dos tipos de inmunoglobulinas, es la presencia, en la IgG de mamíferos, de una bisagra entre Cγ1 y Cγ2 la cual le da mayor flexibilidad, comparado con la IgY en la que hay menor flexibilidad debido a la

(21)

12

ausencia de esta. Algunas regiones en la IgY que contienen residuos de prolina y glicina que le confieren una flexibilidad limitada. Además, la IgY es más hidrofóbica y posee un punto isoeléctrico de 5.7 – 7.6 (Narat 2003; Yoshimura 2004).

Figura 2. Estructura de la IgG y la IgY. Diferencias estructurales entre las inmunoglobulinas. Tomado de Narat, 2003.

Estas diferencias estructurales están relacionadas con las diferencias moleculares y las interacciones bioquímicas. La mayor diferencia estructural entre la IgY y la IgG está localizada en la región Fc en donde la mayoría de las funciones biológicas efectoras de las inmunoglobulinas son activadas. Las funciones dependientes IgG-Fc son diferentes en la IgY. La IgY no activa el complemento, no se une a la proteína A y G, no se une a anticuerpos de mamíferos reduciendo el riesgo de la obtención de reacciones falsas positivas en los inmunoensayos y no se une a la superficie celular del receptor Fc (Schade et al. 1996; Narat 2003). Todas estas diferencias son ventajas que han permitido la aplicación de los IgY en diferentes métodos en las áreas de investigación como en diagnóstico, medicina y biotecnología (Narat 2003).

En las gallinas, las inmunoglobulinas se transfieren activamente desde los folículos ováricos al huevo a través de una capa jerárquica granulosa de folículos y se acumulan en la yema del huevo como IgY (Chacana, Terzolo et al. 2004; Yoshimura 2004). La extracción de los anticuerpos IgY presentes en la yema del huevo puede hacerse por diferentes métodos. Entre los métodos descritos se encuentra la precipitación con sulfato de sodio o de amonio, Polietilénglicol (PEG), ácido caprílico, Caragenina óftalato de hidroxi-propil-metil-celulosa (De Meulenaer and Huyghebaert 2001), la precipitación con alcoholes, la precipitación con solventes orgánicos, la dilución con agua con cambios de pH, el uso de polisacáridos aniónicos, entre otros. Debido al

(22)

13

alto contenido de lipoproteínas en la yema del huevo, se requiere un paso preliminar para la separación de las proteínas solubles en agua de la fracción lipídica. Las proteínas de la yema del huevo se dividen en 2 partes: los gránulos que están compuestos por α- and β-lipovitelinas (70%), fosvitina (16%) y lipoproteínas de baja densidad (12%) y proteínas plasmáticas que tiene α-, β- y γ-livetinas (IgY) y proteínas de baja densidad (Verdoliva et al. 2000; De Meulenaer and Huyghebaert 2001). Usualmente se utiliza un procedimiento que consiste en la precipitación del material no acuoso con polietilénglicol (PEG), sulfato dextrán o cloroformo, o por agregación proteica de gránulos por medio de la dilución acuosa de la yema del huevo en condiciones débilmente ácidas (Verdoliva et al. 2000).

En trabajos previos realizados en el Instituto de Errores Innatos del Metabolismo (IEIM), se diseñaron cuatro péptidos alineando las secuencias obtenidas de NCBI (National Center of Biotechnology) de las sulfatasas humanas mediante el programa ExPASy Molecular Biology Center en código FASTA y removiendo el péptido señal. Se escogieron inicialmente 49 secuencias, entre 16 y 20 aminoácidos aproximadamente, de la proteína GALNS que no presentaran alta similaridad con las demás sulfatasas (Figura 3). Se observó la ubicación de los péptidos obtenidos en un modelo tridimensional de la proteína GALNS para evaluar y obtener aquellas secuencias que tuvieran una mejor disposición antigénica. Finalmente, se seleccionaron 4 péptidos de secuencias (Tabla 2) no conservadas de la proteína GALNS las cuales presentaban el menor grado de homología entre la familia de proteínas evaluadas (Figura 4).

(23)

14

.

Figura 3. Clustal W Multiple Alignment. Ejemplo de alineamiento entre las sulfatasas GALNS (N-acetil galactosamina -6- sulfato sulfatasa) y ARSA (Aril sulfatasa A) humanas. Se evidencia en rojo los aminoácidos idénticos, en verde los de alta similaridad y en azul los de baja similaridad. La figura muestra una secuencia no conservada entre las dos enzimas.

Tabla 2. Secuencias peptídicas escogidas. a.a: aminoácido

Secuencia Longitud Localización

Péptido 1 GFYTTNAHARNAYTPQEIVG 20 aminoácidos Desde el a.a. 96 al 115

Péptido 2 SPNCHFGPYDNKARPNIPVYR 21 aminoácidos Desde el a.a. 161 al 182

Péptido 3 LQGRLMDRPIFYYRGDTLMAAT 22 aminoácidos Desde el a.a. 373 al 394

Péptido 4 WTNSWENFRQGIDFCPGQNV 20 aminoácidos Desde el a.a. 405 al 424

(24)

15

Figura 4. Localización del péptido señal y de los 4 péptidos seleccionados en la secuencia completa de GALNS (N- acetil galactosamina -6- sulfato sulfatasa) humana.

La producción de anticuerpos policlonales tipo IgY se realizó en un trabajo previo en el IEIM (Instituto de Errores Innatos del Metabolismo) inoculando cada péptido en dos gallinas. Se inoculó el péptido 1 en las gallinas número 2 y 7, el péptido 2 en las gallinas 3 y 8, el péptido 3 en las gallinas 4 y 9 y el péptido 4 en las gallinas 5 y 10. Las gallinas 1 y 6 se utilizaron como control. Los huevos fueron recolectados a diario y almacenados a 4°C hasta su uso.

El proceso de extracción se realizó utilizando cloroformo como solvente orgánico y se realizó titulación de los extractos de proteína solubles mediante ELISA indirecta. Los resultados obtenidos en ese trabajo muestran diferencias en los animales de acuerdo al péptido utilizado, teniendo la actividad más alta en las gallinas inmunizadas con el péptido 3, la gallina 9 (G9) hacia el día 35 y la gallina 4 (G4) hacia los días 28 y 35 (Figura 5). Los controles del ensayo (Gallinas 1 y 6) no presentaron actividad con respecto a los demás animales.

1 MAAVVAATRWWQLLLVLSAAGMGASGAPQPPNILLLLMDDMGWGDLGVYGEPSRETPNLDRMAAEGLLFP 71 NFYSANPLCSPSRAALLTGRLPIRNGFYTTNAHARNAYTPQEIVGGIPDSEQLLPELLKKAGYVSKIVGK 141 WHLGHRPQFHPLKHGFDEWFGSPNCHFGPYDNKARPNIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYL 211 QEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADN 281 TFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSL 351 ALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCP 421 GQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCN 491 WAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH

PEPTIDO

SEÑAL PEPTIDO 1 PEPTIDO 2

PEPTIDO 3 PEPTIDO 4

1 MAAVVAATRWWQLLLVLSAAGMGASGAPQPPNILLLLMDDMGWGDLGVYGEPSRETPNLDRMAAEGLLFP 71 NFYSANPLCSPSRAALLTGRLPIRNGFYTTNAHARNAYTPQEIVGGIPDSEQLLPELLKKAGYVSKIVGK 141 WHLGHRPQFHPLKHGFDEWFGSPNCHFGPYDNKARPNIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYL 211 QEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADN 281 TFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSL 351 ALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCP 421 GQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCN 491 WAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH

PEPTIDO

SEÑAL PEPTIDO 1 PEPTIDO 2

PEPTIDO 3 PEPTIDO 4

(25)

16

Figura 5. Título de anticuerpos extraídos con cloroformo contra la enzima N-acetilgalactosamina-6-sulfato sulfatasa (GALNS). Gallinas 4 y 9 son réplicas, ambas gallinas fueron inmunizadas con el péptido 3. La gallina 1 fue utilizada como control (sin inmunizar).

2.4.2. Producción de anticuerpos policlonales en conejo

La producción de anticuerpos policlonales en conejo se ha usado debido a que posee algunas ventajas como: el tamaño del conejo, su fácil utilización para obtener las muestras de sangre, la obtención de volúmenes adecuados con altos títulos y alta afinidad, la producción de anticuerpos contra proteínas de ratones y humanas. Debido a que este animal ha divergido de los ratones, el tener una clase única de IgG permite la obtención de un anticuerpo predecible en su región Fc funcional determinada, siendo una característica importante en la purificación de los anticuerpos para la utilización de columnas como Protein A y Protein G, y la preparación de anticuerpos anti- halotipos útiles como reactivos en inmunoensayos, debido a que sus inmunoglobulinas poseen numerosas diferencias halotípicas (Hanly et al. 1995). Para la obtención de los anticuerpos (IgG) el método que se utiliza es por sangrado en donde se obtienen aproximadamente 20 ml de suero por semana con un total de 200mg de anticuerpos de los cuales un 5% (10mg) corresponden a anticuerpos específicos (Hanly et al. 1995).

2.5. Purificación de anticuerpos

La purificación de anticuerpos se hace con el propósito de evitar la reactividad de los anticuerpos mediante la remoción de otras proteínas acompañantes. Existen diferentes tipos de métodos para

(26)

17

la purificación (Tabla 3) y dependen de varios factores como el nivel de pureza requerido, la clase y el tipo de anticuerpo y su aplicación. La separación de los anticuerpos por tamaño o por carga se puede realizar utilizando las diferentes técnicas de purificación de proteínas (Stapleton et al. 2005). Las cromatografías de afinidad (Figura 6) se utilizan para la separación de una proteína específica o de un grupo de proteínas con las mismas características en una matriz. En estas columnas un ligando específico se inmoviliza covalentemente en un soporte sólido, que luego es empacado en una columna cromatográfica. Uno de los métodos más utilizados de la purificación por afinidad es la proteína A y la Proteína G que se unen específicamente a ciertas porciones de la IgG (Stapleton et al. 2005; Roque et al. 2007).

Tabla 3. Diferentes métodos empleados en la purificación de proteínas. Tomado de Stapleton et al. 2005

Técnica Uso Ventajas Desventajas

Precipitación con sulfato de amonio

Usado con otros métodos

Económico, fácil, conveniente para grandes volúmenes

Múltiples pasos, rendimiento moderado

Proteína G Aislamiento IgG Alto rendimiento Costoso

Proteína A Purificación IgG excepto IgG1

Alto rendimiento

Costoso, no se une a IgG1

Cromatografía de alta afinidad

Útil para aislar cualquier tipo de antígeno

Une anticuerpos específicos

Requiere de una columna específica

IMAC

Aislamiento de anticuerpos recombinantes

Alto rendimiento

Formación de cuerpos de inclusión, difícil

solubilización

Filtración en gel Relativa pureza de IgM

Económico, útil para grandes volúmenes, no requiere de cambios extremos de pH

Poco útil para la separación de IgG

(27)

18

Figura 6. Esquema general de la purificación de anticuerpos por cromatografía de afinidad. Tomado de Roque, 2007.

La purificación de los anticuerpos de conejo comúnmente se realiza utilizando la columna de afinidad Proteína A, ya que posee una alta selectividad y una alta estabilidad fisicoquímica siendo un ligando útil para la purificación de la IgG. La proteína A es una proteína de 42 kDa que se encuentra en las paredes celulares de Staphylococcus aureus, tiene la capacidad de unirse a la porción Fc de un amplio rango de anticuerpos por medio de interacciones hidrofóbicas con algunos puentes de hidrógeno y 2 puentes salinos, excepto a la clase IgG1 de ratón, IgG3 humana y a la mayoría de anticuerpos monoclonales de la rata a los que se une débilmente (Hahn et al.

2003). La liberación de la mayoría de las IgG se realiza a un pH bajo, cuando se utiliza un buffer de elución común como glicina-HCl a pH 3.0 (Biotech 1998; Hahn et al. 2003). Esta proteína se puede acoplar a varias matrices para columnas de afinidad debido a la conveniencia en su uso.

Una de las columnas más utilizadas para inmovilizar la proteína A es la columna de afinidad HiTrap Protein A debido a que su capacidad de unión a la IgG humana es de 20 mg IgG/ml, la densidad del ligando por ml de gel es de 3mg Proteína A, el flujo es de 4ml/min en una columna de 1 ml, y la estabilidad del gel se da a pH 3-9 (Biotech 1998).

En la purificación de los anticuerpos IgY se utilizan otros métodos debido a que este tipo de inmunoglobulinas no se unen a las proteínas A o G. Entre las más usadas se encuentran: la precipitación con sulfato de sodio, de amonio, con etanol o con polietilenglicol (PEG) y la cromatografía, entre las que se encuentran la cromatografía tiofílica, las de afinidad, las de intercambio aniónico y catiónico, las de interacción hidrofóbica; la filtración, con técnicas como

(28)

19

la ultrafiltración, la filtración en columna y la diafiltración, entre otras (De Meulenaer and Huyghebaert 2001).

La cromatografía de interacción tiofílica fue descrita por Porath y colaboradores (1985), se conoce con el nombre de T-gel debido a la reacción que se da entre dos ligandos como el 2- mercaptoetanol y la divinilsulfona, los cuales activan el soporte o matriz utilizado (sefarosa) resultando en un grupo tioéter en proximidad a un grupo sulfona (Porath et al. 1985; Scoble and Scopes 1997; Hansen et al. 1998; Boschetti 2001). Durante el proceso de purificación utilizando esta cromatografía de afinidad se realizan tres pasos fundamentales: la activación del soporte o matriz con el ligando, la adsorción o unión de la proteína al ligando (Figura 6B) y la elución de la proteína de interés (Figura 6D). La columna tiofílica permite la separación de inmunoglobulinas de otro tipo de proteínas presentes en solución, la interacción tiofílica no se ve afectada por la variación de la temperatura lo que le da ventajas frente a otros métodos como la interacción hidrofóbica que pierde su capacidad de interacción a medida que la temperatura aumenta. La adsorción al soporte activo (sefarosa) es promovida por la adición de sales asegurando que las moléculas diana interactúen con el ligando y se retengan por afinidad con el medio, se cree que la sal incrementa o facilita el contacto de la proteína con el grupo tioéter-sulfona. El uso de cloruro de sodio (NaCl) en T-gel disminuye la capacidad de interacción, por lo que debe hacerse uso de sales liotrópicas como sulfato de amonio, sulfato de potasio o sulfato de sodio que ayuden a la interacción ligando-anticuerpo (Scoble and Scopes 1997; Boschetti 2001). El proceso de separación de las moléculas unidas al soporte o elución, se realiza disminuyendo la concentración de las sales utilizadas (Scoble and Scopes 1997). Este tipo de cromatografía ha sido una de las más utilizadas ya que es un proceso simple, de bajo costo y alta especificidad. El mecanismo de unión fue descrito como la formación de un complejo donador-aceptor de electrones entre las regiones adyacentes ricas en electrones y aquellas deficientes situadas sobre la proteína; siendo el donador el grupo tioéter y el aceptor la sulfona del ligando (Hansen et al. 1998; Boschetti 2001).

(29)

20 3. MATERIALES Y MÉTODOS

3.1. Purificación de anticuerpos IgY

Se utilizó como soporte sefarosa CL-4B (Sigma) activada con divinil sulfona, DVS (Fluka) y 2- mercaptoetanol (Sigma). La purificación se realizó siguiendo la metodología sugerida por (Hansen et al. 1998): 5mL de sefarosa CL- 4B se lavaron con agua desionizada y con carbonato de sodio 0.5M hasta obtener un pH de 12. Se adicionaron 400L de DVS y se mantuvo en agitación constante durante 16h. El soporte se lavó con agua desionizada, hasta obtener un pH ácido y con carbonato de sodio 0.5M hasta un pH básico. Se adicionó el mismo volumen (400L) de 2-mercaptoetanol (Sigma), se incubó y se lavó en las condiciones descritas anteriormente.

Finalmente, la sefarosa activa se equilibró con la solución 1 (Fosfato 50mM pH 7.5 y Sulfato de sodio 0.5M). Todo el proceso de la purificación se realizó utilizando el equipo Biologic LP Chromatography system de BioRad™. La sefarosa activa se empacó en Econo-Column Chromatography Columns de BioRad™. Se equilibró con la solución 1 y se adicionaron diferentes diluciones de la muestra (IgY totales) en la misma solución (7ml, 10ml y 15 ml). La columna se lavó con la solución 1 y se recogieron las fracciones hasta obtener una lectura de absorbancia a 280nm igual a cero. Para eluir las proteínas retenidas, se adicionó la solución 2 (fosfato de sodio 50mM, pH 7.4). Las fracciones obtenidas durante el proceso se almacenaron a - 20ºC para su posterior análisis por electroforesis de poliacrilamida SDS–PAGE, Western Blot y ELISA indirecta. Se realizaron pruebas de eficiencia de la columna en donde se utilizó la solución 2 y se adicionó de muestra la solución 1. Los datos se colectaron en LP Data View Software. Los resultados se analizaron estadísticamente (α= 95%) mediante un ANOVA de dos vías y los métodos de comparación múltiple Student-Newman-Keuls.

3.1.1. Marcaje de anticuerpos purificados IgY anti-GALNS con biotina

Los anticuerpos purificados se biotinilaron usando NHS LC Biotin (Pierce) siguiendo el procedimiento descrito por el fabricante.

3.2. Determinación de proteínas totales por el método de Folin-Lowry

Se determinaron las concentraciones de los anticuerpos purificados IgY anti-GALNS e IgG anti- GALNS utilizando el método de Folin-Lowry (Lowry et al. 1951). Se agregaron 10µl de cada muestra en un tubo de vidrio, 100µl de SDS (Dodecil Sulfato de Sodio) al 1% y 100µl de reactivo

(30)

21

de cobre. Se mezclaron los tubos y se dejó en incubación a temperatura ambiente durante 10 minutos. Transcurrido este tiempo se adicionó a la mezcla anterior 400µl de reactivo de Folin Cicolteau al 6,5%. Se mezcló y se incubó en baño María por 5 minutos a 56°C y posteriormente se detuvo la reacción colocando durante 5 minutos el tubo de vidrio en 4°C. Las absorbancias se leyeron en el espectofotómetro (BioSpec–1601 Shimadzu) a 610nm. Las concentraciones de las muestras se determinaron frente a la curva de calibración BSA (Albúmina Sérica Bovina) usando Solución Stock de Albúmina al 0,4%.

3.3. Electroforesis en gel de poliacrilamida

La electroforesis en gel de poliacrilamida se realizó en un gel de poliacrilamida al 10% en condiciones no reductoras diluyendo las muestras en tampón Laemmli (BioRad), y en condiciones reductoras diluyendo las muestras en 2-mercaptoetanol (M3148 SIGMA®) y tampón Laemmli. Se mantuvieron las condiciones de corrido a 120V, 60 mA durante 2 horas aproximadamente. Los geles se tiñeron con azul de Coomassie (Sigma) y se decoloraron utilizando solución decolorante (40ml Metanol, 50 ml H2O, 10 ml de Ácido Acético).

3.4. Detección de GALNS mediante ELISA indirecta

En microplacas de 96 pozos de poliestireno (Nunc Maxisorp®) se fijaron 50 µl de la proteína GALNS a 1000 ng/ml en PBS (1.194g Na2HPO4, 0.256g NaH2PO4·H2O y 8.766g NaCl; pH 7.2- 7.4), se incubó toda la noche a temperatura ambiente en cámara húmeda. Se bloqueó con 200µl/pozo de la solución 1 (PBS - Tween 20 0.05%-Leche descremada 5%) incubando durante 2 horas a 37°C en cámara húmeda. La placa se lavó 2 veces con PBS-Tween 0.05%.

Posteriormente, en solución 2 (PBS – Tween 20 0.025% - Leche 2.5%) se adicionaron las muestras purificadas de IgY anti- GALNS, IgY preinmune en una dilución 1/600, y muestras purificadas de IgG anti-GALNS y del conejo control en una dilución de 1/1000. Se adicionaron 100µl/pozo y se incubó durante 1 hora a 37°C en cámara húmeda. La placa se lavó 4 veces con PBS–Tween 0.05%. Se adicionó a la placa con las muestras purificadas de IgY 100µl/pozo del anticuerpo conjugado anti chicken HRP (Promega) diluido 1/2000 en la solución 2; y a la placa con las muestras purificadas de IgG 100µl/pozo del anticuerpo conjugado anti-Rabbit conjugado con peroxidasa (SIGMA) diluido 1/2000 en la solución 2, (se incubó durante 1 hora a 37°C en cámara húmeda). La placa se lavó 3 veces en las condiciones anteriormente descritas.

Finalmente, se adicionaron 100µl del sustrato de reacción TMB 3,3´,5,5´tetrametilbenzidina

(31)

22

(Sure Blue Reseved KPL), la reacción enzimática se detuvo con HCL 1N. La placa se leyó a 450nm de absorbancia en un lector Anthos 2020. Se utilizó como control negativo la enzima Iduronato 2-sulfato-sulfatasa (IDS).

3.5. Western Blot

Con el objetivo de probar la capacidad de los anticuerpos (IgG e IgY) para reconocer toda la molécula de GALNS se realizó la técnica de Western Blot. GALNS co-expresada con SUMF1 (Tomatsu et al. 2008) en una concentración de 3 µg, anticuerpos IgG e IgY anti-GALNS purificados y plasma EDTA humano (dilución 1/5) se corrieron en una electroforesis SDS-PAGE 10% y se transfirieron a las membranas de nitrocelulosa Hybond C-Extra 0.22nm (RPN203E Amersham Bioscience®), activadas con buffer de transferencia pH 8.3 (3.03g Tris base, 14.04g Glicina, 1g SDS, 200ml Metanol y agua desionizada hasta volumen de 1L), durante 2 horas a 100V y 350mA como condiciones de transferencia. Las membranas se bloquearon con solución TBS - Tween 0.2% - leche descremada 5% por 2 horas a temperatura ambiente. Se realizaron 2 lavados con TBS – Tween 0.2% durante 5 minutos cada uno. Se adicionó el anticuerpo IgY anti- GALNS purificado en una dilución de 1/1000 a la membrana transferida con el anticuerpo IgG anti-GALNS purificado, e IgG anti-GALNS purificado a la membrana transferida con el anticuerpo IgY anti-GALNS purificado en una dilución de 1/2000, ambas soluciones en TBS - Tween 0.2% - leche descremada 5%. Se realizaron lavados con TBS- Tween 0.2% durante 5 minutos cada uno. Una membrana se incubó durante 1 hora en agitación con anti-Chicken IgY HRP conjugate (Promega G1351) en una dilución de 1/1000 y la otra membrana con anti-Rabbit conjugado con peroxidasa (SIGMA®) en una dilución de 1/5000, posteriormente se realizaron 5 lavados en las condiciones descritas anteriormente. La prueba se reveló con diaminobenzidina (D8001 SIGMA®).

3.6. Producción y Purificación de IgG α-GALNS

Dos conejos de raza nueva Zelanda blanca de un mes de edad fueron inoculados con la mezcla de los péptidos 1, 2 y 4 de la enzima GALNS previamente sintetizados (Tabla 2). Cada uno de los péptidos se emulsificó en 500 µl de adyuvante completo o incompleto de Freund. Se realizaron 4 inoculaciones cada ocho días con los péptidos de GALNS (100µg/ml), la primera inoculación se realizó con adyuvante completo de Freund y las siguientes inoculaciones con adyuvante incompleto de Freund. Un conejo se utilizó como control realizando las 4 inoculaciones con PBS

(32)

23

y el adyuvante completo o incompleto de Freund. Los anticuerpos se purificaron mediante la columna de afinidad Hi-Trap Protein A (Amersham Pharmacia Biotech) siguiendo el protocolo descrito por la casa comercial. La evaluación de la purificación se realizó por Western-blot y electroforesis SDS-PAGE 10%.

3.7. ELISA tipo “sandwich”

Se fijaron 70µl/pozo del anticuerpo de captura previamente purificado, en microplacas de 96 pozos de poliestireno (Nunc Maxisorp) y se incubó a 37°C toda la noche en cámara húmeda. Se realizaron 5 lavados con PBS – Tween20 0.05%. Se bloqueó con 200µl/pozo de la solución 1 (PBS - Tween20 0.05%-Leche descremada 5%) incubando durante 2 horas a 37°C en cámara húmeda. Se adicionó 1, 2, 4 y 5 ug/ml de la enzima GALNS en PBS durante 1 hora a temperatura ambiente en cámara húmeda. Se realizaron 5 lavados con PBS – Tween20 0.05%. Se adicionaron 70 ul del anticuerpo de reconocimiento (marcado con biotina o sin marcar) y se incubó 37°C toda la noche en cámara húmeda. Se hicieron 7 lavados con PBS-Tween20 0.05%.

Se adicionaron 70 ul de estreptavidina marcada con peroxidasa, de anti-Chiken HRP, anti-Rabbit o anti-Mouse. Se realizaron 5 lavados con PBS-Tween 20 0.05%. Finalmente se adicionó el sustrato de reacción TMB 3,3´,5,5´tetrametilbenzidina (Sure Blue Reseved KPL) y la reacción enzimática se detuvo con HCL 1N. La placa se leyó a 450nm de absorbancia en un lector Anthos 2020. Se utilizó como control negativo de GALNS la enzima IDS.

Se probaron diferentes condiciones de tiempo de incubación (del antígeno, bloqueo y anticuerpos de captura y reconocimiento), concentraciones del anticuerpo de captura, reconocimiento y GALNS, tipo de bloqueo (Leche ó BSA), número de lavados, detergente del lavado (Tween20 al 0.05%, Triton 100X al 0.1%), tipo de anticuerpo utilizado como captura o como anticuerpo de reconocimiento, tipo de buffer de captura (PBS pH=7.4 y Carbonato de sodio pH=9.6) (Figura 7), diferentes condiciones de temperatura para la incubación de los anticuerpos (37°C toda la noche, temperatura ambiente toda la noche, 4°C toda la noche, 37°C durante 3 horas junto con 15 horas 4°C, 37°C durante 3 horas junto con 15 horas a 4°C). Adicionalmente, se realizó una prueba con un anticuerpo monoclonal anti-GALNS (Tomatsu et al. 2003) utilizándolo como anticuerpo de reconocimiento y el anticuerpo de gallina como anticuerpo de captura.

(33)

24

Figura 7. Ensayos con diferentes condiciones de la ELISA tipo “sandwich”. A. Uso de diferentes concentraciones del anticuerpo de captura (IgG anti-GALNS producido en conejo), de reconocimiento (IgY anti-GALNS producido en gallina) y de la enzima GALNS (N-acetilgalactosamina-6- sulfato sulfatasa). B. Condiciones de bloqueo: tipo de bloqueo con BSA (Albúmina Sérica Bovina) y leche descremada al 5%; tiempo de bloqueo de 2 horas, 2:30 horas, y 3 horas con leche descremada al 5%; solución de bloqueo en PBS (Buffer fosfato salino) y en PBS tween20 0.05%

durante diferentes horas de bloqueo (1:30h, 1:45 y 2 horas).

Figura 8. Ensayos con diferentes condiciones de la ELISA tipo “sandwich”. Prueba usando diferente número de lavados y del detergente de lavado.

Anticuerpo de reconocimiento (IgY) biotinilado Diferentes Concentraciones

Anticuerpo de captura (IgG)

1/50 1/100 1/200 1/400 1/800 1/1600 1/250

1/500 1/1000 1/2000 1/4000 1/8000 1/16000 1/32000

GALNS

1 ug/ml 5ug/ml

Lavado s Número de

lavados

5 lavados 7 lavados PBS tween 20 0.05%

3 lavados 5 lavados Sin lavados Después del anticuerpo de captura

Después del anticuerpo de reconocimient o

Detergente de lavado

PBS Triton 100X 0,1%

Tiempo de bloqueo

Bloqueo

Tipo de bloqueo

BSA 2%

Leche 5%

Solución de bloqueo

2:00h 2:30h 3:00h

1:30h 1:45h 2:00h PBS tween

PBS

Tiempo de bloqueo

Referencias

Documento similar

grupos de interés ... La información sobre las actuaciones administrativas automatizadas y los algoritmos utilizados por las Ad- ministraciones públicas ... Fortalecer la calidad

quiero también a Liseo porque en mi alma hay lugar para amar a cuantos veo... tiene mi gusto sujeto, 320 sin que pueda la razón,.. ni mande

que hasta que llegue el tiempo en que su regia planta ; | pise el hispano suelo... que hasta que el

Para ello, trabajaremos con una colección de cartas redactadas desde allí, impresa en Évora en 1598 y otros documentos jesuitas: el Sumario de las cosas de Japón (1583),

En suma, la búsqueda de la máxima expansión de la libertad de enseñanza y la eliminación del monopolio estatal para convertir a la educación en una función de la

Sanz (Universidad Carlos III-IUNE): "El papel de las fuentes de datos en los ranking nacionales de universidades".. Reuniones científicas 75 Los días 12 y 13 de noviembre

(Banco de España) Mancebo, Pascual (U. de Alicante) Marco, Mariluz (U. de València) Marhuenda, Francisco (U. de Alicante) Marhuenda, Joaquín (U. de Alicante) Marquerie,

6 Para la pervivencia de la tradición clásica y la mitología en la poesía machadiana, véase: Lasso de la Vega, José, “El mito clásico en la literatura española