Biofísica Trabajo Práctico Número 1

11  Descargar (0)

Texto completo

(1)

Biofísica

Trabajo Práctico Número 1

Para comenzar con la actividad abra una terminal de Linux, y ejecute el programa. Esto se hace escribiendo la palabra “pymol” y luego Enter. Se abrirán dos ventanas como las observadas a continuación, la de arriba es la ventana principal de PyMOL y la de abajo es el visualizador (PyMOL Viewr). En el esquema se señalan algunos botones y funciones que serán utilizadas durante este trabajo práctico.

(2)

Antes de empezar propiamente con el primer ejercicio del trabajo aquí encontrará algunos tips para manejar PyMOL:

- Manteniendo pulsado el botón izquierdo del mouse (y desplazando el mismo) en el fondo negro podrá rotar la estructura.

- Manteniendo pulsado el botón derecho del mouse (y desplazando el mismo) en el fondo negro podrá hacer zoom.

- Manetiendo pulsado el botón central del mouse (y desplazando el mismo) podrá desplazar la estructura.

- Resulta útil poder visualizar la secuencia de aminoácido de la molécula con la cual se está trabajando, para ello en la barra de menú seleccionar Display Sequence .

- (En la linea de comandos) mediante los comandos: hide y show, combinados con los comandos: all, cartoon, sticks, lines, etc, puede elegirse la forma en que el programa muestra la molécula. A continuación se muestra a modo de ejemplo la sintaxis de tres comandos:

hide all show cartoon show lines

Luego de esta breve introducción al uso de PyMOL se da comienzo al Trabajo Práctico Número 1 de Biofísica.

Construcción de péptidos

Utilizando el PyMOL construir el siguiente péptido:

KYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKE

1. En la barra de menú seleccionar Build → Residue y elegir Helix. Esta es una de las opciones de estructura secundaria permitida por PyMOL.

2. En la barra de menú seleccionar Build → Residue y elegir el primer aminoácido de la secuencia. Repita este paso para todos los residuos de la primera hélice alfa.

(3)

terminal y C terminal. Para ello, seleccione (Ctrl + botón del medio) el oxígeno en el grupo C terminal.

4. Luego, cambie el estado de ionización: en la barra de menú seleccionar Build → Make (pk1) Negative y a continuación corrija la valencia mediante Build Fill→ Hydrogens on (pk1).

5. Elimine la selección mediante el botón Unpick en la ventana menú. 6. Seleccione (Ctrl + botón del medio) el nitrógeno en el grupo N terminal.

7. Luego, cambie el estado de ionización: en la barra de menú seleccionar Build → Make (pk1) Positive y a continuación corrija la valencia mediante Build → Fill Hydrogens on (pk1).

8. Elimine la selección mediante el botón Unpick en la ventana menú.

9. Guarde el trabajo hasta aquí realizado, para ello en la barra de menú seleccionar File → Save Session (Este paso será repetido varias veces a lo largo del TP. Se aconseja generar un nuevo archivo cada vez que se guarde el avance, por lo que es conveniente agregarle un número al nombre del archivo de modo de mantener un orden secuencial lógico).

10. Continuar con la construcción del péptido: para ello se le ha de indicar al PyMOL desde donde se desea prolongar la cadena. Seleccionar el carbono alfa del residuo C terminal (Ctrl + botón del medio).

11. A continuación, en la barra de menú seleccionar Build → Residue y elegir el primer aminoácido del loop. Repita este paso para todos los residuos del mismo. (Note que en este paso no se ha seleccionado ningún tipo de estructura secundaria.)

12. Para concluir con la construcción del loop repita los pasos: 7, 8, y 9.

13. A continuación, y para finalizar la construcción del péptido repita los pasos del 1 al 9 de modo de obtener la segunda hélice alfa.

14. Guarde la molécula construida en formato PDB, en la barra de menú seleccionar File → Save Molecule. Aquí se le preguntará por el objeto que desea guardar, seleccione la molécula a ser guardada y a continuación deberá elegir un nombre de archivo y el formato que desea (el formato por default es PKL, en el menú desplegable seleccione PDB).

15. Habiendo terminado con esta parte del TP, limpie todo: haga click en el botón A (Acción, ver Figura 2) que aparece en la parte superior derecha de la ventana PyMOL Viewer, y del menú desplegable seleccione la opción delete everything.

(4)

Llegado este punto, se ha construido un péptido de 47 aminoácido, esta estructura NO se encuentra en el mínimo de energía por lo que es necesario aplicar el proceso denominado Minimización para llevarla a dicho mínimo. A los efectos de este trabajo práctico se les entrega el péptido ya minimizado: myoglobin_amber-min.pdb

A continuación se obtendrá una medida de la divergencia estructural entre la molécula por usted construida y la misma luego de ser minimizada. Una buena medida del grado de divergencia estructural entre dos moléculas viene dada por el RMSD (root-mean-square deviation, por sus siglas en inglés).

Calculó del RMSD mediante PyMOL

1. Si aún tiene abierto el PyMOL aseguresé de haber borrado todo (paso 15 de la etapa anterior). Si lo cerró, ábralo nuevamente escribiendo en la terminal la palabra “pymol” y luego Enter.

2. En la barra de menú seleccione File Open. Se abrirá una ventana en la cual→ debe seleccionar el archivo PDB que corresponde a la molécula que usted ha construido.

3. A continuación repita el paso anterior pero esta vez abra el PDB denominado myoglobin_amber-min.pdb

4. Mediante el comando align el PyMOL calcula el RMSD entre ambas estructuras. En la línea de comandos de la ventana principal de PyMOL escriba la siguiente sentencia:

align nombre_archivo_pdb_suyo, myoglobin_amber-min.pdb No olvide la “,” luego del primer nombre de archivo.

5. En la lista de comandos que se observan en la ventana principal podrá visualizar el valor de RMSD resultante. ¿Cual es el RMSD entre las dos moléculas en cuestión?

6. Según lo que puede observar, ¿a que se debe la divergencia estructural observada?

Superficie de Contacto con el Solvente

La Superficie de Accesibilidad al Solvente (descripta por primera vez en 1971 por Lee & Richards) (ASA: accessible surface area o SASA: solvent-accessible surface area) es la superficie de una biomolécula que es accesible a un solvente.

(5)

Normalmente el ASA se mide en angstroms cuadrados. El ASA se calcula normalmente utilizando el método de la bola rodante (“rolling ball” Shrake & Rupley 1973), este método utiliza una esfera de un radio particular como sonda para medir la superficie de la molécula. El radio depende de la molécula de solvente, dado que la esfera simula el solvente, en el caso del agua el radio de la esfera vale 1.4 angstroms.

La Superficie de contacto con el Solvente, se obtiene de modo similar a la ASA. En este caso la sonda utilizada no es una esfera sino los radios de van der Waals de los átomos que forman el solvente. Por lo que esta medida representa una mejor aproximación a lo que sucede in vivo.

Para comenzar esta parte del práctico se debe descargar el PDB a utilizar, el mismo corresponde a la estructura de la Hemoglobina y su código PDB es: 2HHB.

Entrar al sitio: http://www.rcsb.org/pdb/home/home.do. Una vez allí ingresar el código 2HHB en la barra de búsqueda:

Descargar el archivo Text de la ventana desplegable Download Files en la derecha del navegador. Y guardarlo en la carpeta donde se está trabajando.

(6)

En esta parte del trabajo práctico se calculará la superficie de contacto entre las cadenas A y B de la Hemoglobina. Se calculará la superficie de contacto de la cadena A y de la cadena B como objetos separados, así también se calculará la superficie de las cadenas A y B como un único objeto, y restando la segunda menos las dos primera se obtendrá la superficie de contacto entre ambas cadenas. Para ello, una vez descargado el PDB de la Hemoglobina y guardado en la carpeta de trabajo, abra una Terminal de Linux y entre en la carpeta donde guardó la estructura en cuestión, desde allí:

1. Ejecute PyMOL: escriba pymol en la Terminal y a continuación Enter.

2. En la barra de menú seleccionar File Open , elija el PDB correspondiente a la Hemoglobina y ábralo.

3. En la linea de comandos escriba: hide all, y luego show cartoon

4. A continuación encontrará la lista de comandos (y su explicación entre paréntesis) que le permitirá realizar el cálculo de la superficie de contacto: create alpha1, 2HHB and chain A (creará la cadena A)

create beta1, 2HHB and chain B (creará la cadena B) create ab1, 2HHB and chain A+B (creará la cadena A+B) h_add. (agregará los hidrógenos a todos los átomos)

flag ignore, none (asegura de que todos los átomos dentro de un objeto se ocluyan entre sí)

set dot_solvent, 1

set dot_density, 3 (Este comando más el anterior le indican a PyMOL que utilice ASA con muestreo de alta densidad)

alpha1_area=cmd.get_area("alpha1") (mide el ASA de la cadena A gurdando el valor para utilizarlo posteriormente)

beta1_area=cmd.get_area("beta1") (ídem para la cadena B) ab1_area=cmd.get_area("ab1") (ídem para el par A+B)

Ahora se imprimirán los resultados, tome nota de los valores en el lugar reservado a tal efecto al lado de cada comando:

print alpha1_area (... angstroms²) print beta1_area (... angstroms²) print ab1_area (... angstroms²)

(7)

PyMOL puede mostrar la superficie accesible al solvente usando representaciones de puntos o de esferas.

Para representación por medio de puntos, en la linea de comandos escribir: show dots

set dot_mode,1 set dot_density,3

Para representación por medio de esferas, en la linea de comandos escribir: alter all,vdw=vdw+1.4

show spheres

Así también puede representarse mediante superficies: alter all,vdw=vdw+1.4

show surface

Medida de distancias

Descargue del PDB la estructura cuyo ID es 1A1L guardando la misma en la carpeta de trabajo, o bien muévala luego de haber sido descargada. Abra con PyMOL el PDB descargado. Como ha hecho anteriormente, cambie la forma en que visualiza el archivo para verlo como “cartoon”: hide all y luego show cartoon.

Recuerde activar la barra que muestra la secuencia, para ello en la barra de menú seleccionar Display Sequence. Una vez activada la secuencia, busque los tres átomos de Zn (desplace la barra horizontal que aparece bajo la secuencia). Luego, haciendo click y del menú desplegable que se abrirá seleccione show y spheres.

En la línea de comandos escriba show lines, con ello volverán a aparecer las cadenas laterales.

Ubique uno de los tres átomos de Zn y mediante el mouse rote y traslade la molécula para lograr obtener un buen acercamiento al átomo de Zn elegido. Identifique las dos Cisteínas y las dos Histidinas que forman el complejo de coordinación con el Zinc. En esta parte del práctico se determinará la distancia del metal a cada uno de los átomos a los cuales está enlazado. Para ello, en la barra de menú seleccionar Wizard → Measurement. Esto abrirá un sub-menú abajo a la derecha en la ventana de visualización. Haga click en la opción Distances y del menú desplegable elija Distances. Observe que aparece una leyenda en la parte superior izquierda del visualizador, en la misma se lee “Please click on the first atom...” seleccione con el botón izquierdo del mouse el primer átomo del par al cual va a calcularle la distancia, ahora la leyenda reza “Please click on the second atom...” seleccione el segundo átomo del par. El programa colocará una línea punteada que conecta ambos átomos e informará la distancia entre

(8)

ellos.

Repita el procedimiento para los tres átomos de Zinc y con los valores obtenidos complete la siguiente tabla. En la columna número de residuo coloque el número de residuo de la Histidina o la Cisteína según sea el caso. Un vez concluida la medición de las distancias hacer click en Done (en el sub-menú que aparece abajo a la derecha en el visualizador).

Número de residuo Distancia al Zinc (Å)

Zinc 1 Histidina Histidina Cisteína Cisteína Zinc 2 Histidina Histidina Cisteína Cisteína Zinc 3 Histidina Histidina Cisteína Cisteína

Mapa de contactos de proteínas

Un mapa de contactos representa la distancia entre todos los pares posibles de aminoácidos de una proteína usando una matriz binaria bidimensional, es decir la información presente en la estructura tridimensional de la proteína es representada por una matriz binaria bidimensional. Para dos residuos “i” y “j”, el elemento “ij” de la matriz es 1 si la distancia entre ellos es menor a un cierto umbral (preestablecido de

(9)

antemano), y es 0 si dicha condición no se cumple.

Se han propuesto muchas definiciones de contacto, es decir, que átomos deben ser utilizados para medir la distancia entre residuos: la distancia entre Cα-Cα con un umbral entre 6-12 Å, la distancia entre Cβ-Cβ con un umbral entre 6-12 Å (aquí ha de usarse Cα para las Glicinas), y la distancia entre los centros de masas de las cadenas laterales.

Como se menciono anteriormente, los mapas de contactos proveen una representación más reducida de la estructura tridimensional de una proteína que sus coordenadas atómicas. La ventaja es que los mapas de contactos son invariantes a las rotaciones y translaciones de la molécula. La predicción por métodos computacionales (machine learning) de los mapas es más sencilla. Y ha sido mostrado que bajo ciertas circunstancias es posible reconstruir las coordenadas 3D de una proteína usando su mapa de contactos (Vassura et all. Transactions on Computational Biology and Bioinformatics 5 (3): 357–367 2008).

Dichos mapas son utilizados también para superponer proteínas y para describir la similitud estructural (Holm et all. Science 273 (5275) 1996). Pueden ser predichos a partir de la secuencia o calculados a partir de cierta estructura.

Para comenzar con esta parte del TP debe entrar en la carpeta donde se haya instalado el CMView. Al llegar a esta parte, si aún no se les ha proporcionado esta información, consúltela con el instructor. Suponga que la ruta a la carpeta donde está en programa es: /alumno/CMView/

• En la terminal de Linux escriba: cd /alumno/CMView/ y luego Enter

• Una vez allí, escriba: sh cmview.sh y luego Enter. Esto abrirá el PyMOL en conjunto con el CMView.

• Luego, en la barra de menú de CMView seleccione File Load from PDB file... • Ello abrirá una ventana como la que se ve a continuación:

(10)

• Abra el Browser y cargue el PDB cuyo ID es: 2L4S. • En Chain code elija A (única opción posible en este caso)

• Note que en esta ventana se puede elegir el tipo de contacto (Contact type), en este caso C alpha. Y por otro lado el umbral (cutoff), en este caso 8.0 Å.

• Luego de seleccionar el PDB y la cadena A haga click en OK, esto generará el mapa de contactos deseado:

• Distribuya en la pantalla la ventana del CMView y el Visualizador de PyMOL de modo de ver ambas ventanas simultaneamente.

• Note que al recorrer el mapa de contactos con el puntero del mouse PyMOL muestra el par de aminoácidos “ij”, y a su vez, la distancia entre dicho par. • Recorra el mapa de contactos con el puntero del mouse, identifique y marque en

(11)

el mapa de contactos impreso en el práctico las alfa hélices, las hojas beta paralelas, las hojas beta anti-paralelas, y loops que detecte.

• Note que por el umbral elegido no se observan las hojas beta paralelas. Si se utiliza un umbral de 12 Å en lugar 8.0 Å se obtendrá el siguiente gráfico:

• Identifique y marque en este segundo mapa de contactos las hojas beta anti-paralelas.

• Note como al haber cambiado el umbral se ha obtenido una mayor cantidad de puntos, es decir el “ruido” presente en la señal es mayor, lo cual es lógico porque aumenta la cantidad de pares de residuos considerados para confeccionar el mapa.

Figure

Actualización...

Referencias